Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | mazEF/MazF(toxin) |
| Location | 2046483..2047012 | Replicon | chromosome |
| Accession | NZ_CP102974 | ||
| Organism | Staphylococcus aureus strain 01-RR-86 | ||
Toxin (Protein)
| Gene name | mazF | Uniprot ID | - |
| Locus tag | NW945_RS09975 | Protein ID | WP_000621175.1 |
| Coordinates | 2046483..2046845 (-) | Length | 121 a.a. |
Antitoxin (Protein)
| Gene name | mazE | Uniprot ID | T1YCG8 |
| Locus tag | NW945_RS09980 | Protein ID | WP_000948331.1 |
| Coordinates | 2046842..2047012 (-) | Length | 57 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| NW945_RS09955 (NW945_09955) | 2043461..2044231 | - | 771 | WP_001041103.1 | RNA polymerase sigma factor SigB | - |
| NW945_RS09960 (NW945_09960) | 2044206..2044685 | - | 480 | WP_001190829.1 | anti-sigma B factor RsbW | - |
| NW945_RS09965 (NW945_09965) | 2044687..2045013 | - | 327 | WP_001052491.1 | anti-sigma factor antagonist | - |
| NW945_RS09970 (NW945_09970) | 2045132..2046133 | - | 1002 | WP_000390829.1 | PP2C family protein-serine/threonine phosphatase | - |
| NW945_RS09975 (NW945_09975) | 2046483..2046845 | - | 363 | WP_000621175.1 | type II toxin-antitoxin system PemK/MazF family toxin | Toxin |
| NW945_RS09980 (NW945_09980) | 2046842..2047012 | - | 171 | WP_000948331.1 | type II toxin-antitoxin system antitoxin MazE | Antitoxin |
| NW945_RS09985 (NW945_09985) | 2047097..2048245 | - | 1149 | WP_001281145.1 | alanine racemase | - |
| NW945_RS09990 (NW945_09990) | 2048311..2048670 | - | 360 | WP_000581200.1 | holo-ACP synthase | - |
| NW945_RS09995 (NW945_09995) | 2048674..2049165 | - | 492 | WP_001205910.1 | PH domain-containing protein | - |
| NW945_RS10000 (NW945_10000) | 2049152..2050735 | - | 1584 | WP_258414258.1 | PH domain-containing protein | - |
| NW945_RS10005 (NW945_10005) | 2050728..2051207 | - | 480 | WP_044290680.1 | membrane protein | - |
| NW945_RS10010 (NW945_10010) | 2051416..2051976 | - | 561 | WP_044290681.1 | K(+)-transporting ATPase subunit C | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 121 a.a. Molecular weight: 13441.69 Da Isoelectric Point: 10.1654
>T254760 WP_000621175.1 NZ_CP102974:c2046845-2046483 [Staphylococcus aureus]
MIRRGDVYLADLSPVQGSEQGGVRPVVIIQNDTGNKYSPTVIVAAITGRINKAKIPTHVEIEKKKYKLDKDSVILLEQIR
TLDKKRLKEKLTYLSDDKMKEVDNALMISLGLNAVAHQKN
MIRRGDVYLADLSPVQGSEQGGVRPVVIIQNDTGNKYSPTVIVAAITGRINKAKIPTHVEIEKKKYKLDKDSVILLEQIR
TLDKKRLKEKLTYLSDDKMKEVDNALMISLGLNAVAHQKN
Download Length: 363 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|