Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | tsbAT/- |
| Location | 1885133..1885909 | Replicon | chromosome |
| Accession | NZ_CP102974 | ||
| Organism | Staphylococcus aureus strain 01-RR-86 | ||
Toxin (Protein)
| Gene name | tsbT | Uniprot ID | X5E2E6 |
| Locus tag | NW945_RS09050 | Protein ID | WP_000031108.1 |
| Coordinates | 1885133..1885285 (-) | Length | 51 a.a. |
Antitoxin (Protein)
| Gene name | tsbA | Uniprot ID | W8U4V4 |
| Locus tag | NW945_RS09055 | Protein ID | WP_001251224.1 |
| Coordinates | 1885310..1885909 (-) | Length | 200 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| NW945_RS09035 (NW945_09035) | 1881579..1881974 | - | 396 | WP_000901023.1 | hypothetical protein | - |
| NW945_RS09040 (NW945_09040) | 1882509..1883270 | - | 762 | WP_001066123.1 | IS21-like element helper ATPase IstB | - |
| NW945_RS09045 (NW945_09045) | 1883263..1884555 | - | 1293 | WP_029550026.1 | IS21 family transposase | - |
| NW945_RS09050 (NW945_09050) | 1885133..1885285 | - | 153 | WP_000031108.1 | SAS053 family protein | Toxin |
| NW945_RS09055 (NW945_09055) | 1885310..1885909 | - | 600 | WP_001251224.1 | glucosamine-6-phosphate isomerase | Antitoxin |
| NW945_RS09060 (NW945_09060) | 1886068..1886538 | - | 471 | WP_000181394.1 | tRNA (uridine(34)/cytosine(34)/5- carboxymethylaminomethyluridine(34)-2'-O)- methyltransferase TrmL | - |
| NW945_RS09065 (NW945_09065) | 1886543..1887670 | - | 1128 | WP_000379980.1 | tRNA epoxyqueuosine(34) reductase QueG | - |
| NW945_RS09070 (NW945_09070) | 1887821..1888543 | - | 723 | WP_000590809.1 | amino acid ABC transporter ATP-binding protein | - |
| NW945_RS09075 (NW945_09075) | 1888536..1889993 | - | 1458 | WP_000649908.1 | ABC transporter permease subunit | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | flank | IS/Tn | - | - | 1882509..1883273 | 764 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 51 a.a. Molecular weight: 5936.28 Da Isoelectric Point: 3.8962
>T254759 WP_000031108.1 NZ_CP102974:c1885285-1885133 [Staphylococcus aureus]
MSKDKDPKLNYHEEENSMVTDFEDLKELGKEMEQISDQNDQEKNSEEDSQ
MSKDKDPKLNYHEEENSMVTDFEDLKELGKEMEQISDQNDQEKNSEEDSQ
Download Length: 153 bp
Antitoxin
Download Length: 200 a.a. Molecular weight: 22343.47 Da Isoelectric Point: 5.1445
>AT254759 WP_001251224.1 NZ_CP102974:c1885909-1885310 [Staphylococcus aureus]
MAMNFKVFDNSQLVAEYAADIIRKQFNNNPTTIAGFHLDTDQAPVLDELKKNVEKHAVDFSQINILDYDDKKSYFEALGV
PAGQVYPIAYEKDAIELIADKIKTKENKGKLTLQVVSIDEQGKLNVSIRQGLMEAREIFLVVTGANKRDVVEKLYQENGK
TSFEPADLKAHRMVNVILDKEAAAGLPEDVKAYFTSRFA
MAMNFKVFDNSQLVAEYAADIIRKQFNNNPTTIAGFHLDTDQAPVLDELKKNVEKHAVDFSQINILDYDDKKSYFEALGV
PAGQVYPIAYEKDAIELIADKIKTKENKGKLTLQVVSIDEQGKLNVSIRQGLMEAREIFLVVTGANKRDVVEKLYQENGK
TSFEPADLKAHRMVNVILDKEAAAGLPEDVKAYFTSRFA
Download Length: 600 bp
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|