Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) TsaAT/-
Location 832864..833341 Replicon chromosome
Accession NZ_CP102974
Organism Staphylococcus aureus strain 01-RR-86

Toxin (Protein)


Gene name TsaT Uniprot ID T1Y7S2
Locus tag NW945_RS03960 Protein ID WP_000052076.1
Coordinates 832864..833052 (-) Length 63 a.a.

Antitoxin (Protein)


Gene name TsaA Uniprot ID T1Y6P8
Locus tag NW945_RS03965 Protein ID WP_001059690.1
Coordinates 833081..833341 (-) Length 87 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
NW945_RS03930 (NW945_03930) 828819..829376 + 558 WP_258414568.1 hypothetical protein -
NW945_RS03935 (NW945_03935) 829717..830403 + 687 WP_001641381.1 thermonuclease family protein -
NW945_RS03940 (NW945_03940) 830760..830960 + 201 WP_001059082.1 cold-shock protein -
NW945_RS03945 (NW945_03945) 831455..831673 - 219 WP_000005886.1 hypothetical protein -
NW945_RS03950 (NW945_03950) 831735..832019 - 285 WP_001004401.1 hypothetical protein -
NW945_RS03955 (NW945_03955) 832107..832676 - 570 WP_001106655.1 lipoprotein N-acylation protein LnsA -
NW945_RS03960 (NW945_03960) 832864..833052 - 189 WP_000052076.1 hypothetical protein Toxin
NW945_RS03965 (NW945_03965) 833081..833341 - 261 WP_001059690.1 hypothetical protein Antitoxin
NW945_RS03970 (NW945_03970) 833682..833885 + 204 WP_000145163.1 sterile alpha motif-like domain-containing protein -
NW945_RS03975 (NW945_03975) 833882..834118 - 237 WP_000368687.1 hypothetical protein -
NW945_RS03980 (NW945_03980) 834343..834924 + 582 WP_001140693.1 histidine phosphatase family protein -
NW945_RS03985 (NW945_03985) 834997..835614 - 618 WP_000255561.1 LysE/ArgO family amino acid transporter -
NW945_RS03990 (NW945_03990) 835769..836263 - 495 WP_000569884.1 GNAT family N-acetyltransferase -
NW945_RS03995 (NW945_03995) 836662..837084 - 423 WP_000974460.1 organic hydroperoxide resistance protein -
NW945_RS04000 (NW945_04000) 837232..837948 + 717 WP_000150019.1 type I 3-dehydroquinate dehydratase -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin


No domain identified.


Antitoxin


No domain identified.



Sequences

Toxin        


Download         Length: 63 a.a.        Molecular weight: 7142.82 Da        Isoelectric Point: 9.9971

>T254757 WP_000052076.1 NZ_CP102974:c833052-832864 [Staphylococcus aureus]
MSLHFAILFWLALIFLVAATFILVLMKKTGKESKKESYLSFTVILYIFGFAILIYTFIFGVL

Download         Length: 189 bp

Antitoxin


Download         Length: 87 a.a.        Molecular weight: 9940.09 Da        Isoelectric Point: 4.0624

>AT254757 WP_001059690.1 NZ_CP102974:c833341-833081 [Staphylococcus aureus]
MNNILLNAINIVITTTFVIFNILITYNKDLDDLCWLLPGIIICGVILIVSFTIAMITKNWLSEILFFINIVLVLYYIYPI
FYSFIG

Download         Length: 261 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A0E0VP18

Antitoxin

Source ID Structure
AlphaFold DB A0A0E0VN56

References