Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | mazEF/MazF(toxin) |
Location | 2096618..2097147 | Replicon | chromosome |
Accession | NZ_CP102972 | ||
Organism | Staphylococcus aureus strain 05-RR-90 |
Toxin (Protein)
Gene name | mazF | Uniprot ID | - |
Locus tag | NW963_RS10350 | Protein ID | WP_000621175.1 |
Coordinates | 2096618..2096980 (-) | Length | 121 a.a. |
Antitoxin (Protein)
Gene name | mazE | Uniprot ID | T1YCG8 |
Locus tag | NW963_RS10355 | Protein ID | WP_000948331.1 |
Coordinates | 2096977..2097147 (-) | Length | 57 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
NW963_RS10330 (NW963_10325) | 2093596..2094366 | - | 771 | WP_001041107.1 | RNA polymerase sigma factor SigB | - |
NW963_RS10335 (NW963_10330) | 2094341..2094820 | - | 480 | WP_001190829.1 | anti-sigma B factor RsbW | - |
NW963_RS10340 (NW963_10335) | 2094822..2095148 | - | 327 | WP_001052491.1 | anti-sigma factor antagonist | - |
NW963_RS10345 (NW963_10340) | 2095267..2096268 | - | 1002 | WP_000390829.1 | PP2C family protein-serine/threonine phosphatase | - |
NW963_RS10350 (NW963_10345) | 2096618..2096980 | - | 363 | WP_000621175.1 | type II toxin-antitoxin system PemK/MazF family toxin | Toxin |
NW963_RS10355 (NW963_10350) | 2096977..2097147 | - | 171 | WP_000948331.1 | type II toxin-antitoxin system antitoxin MazE | Antitoxin |
NW963_RS10360 (NW963_10355) | 2097232..2098380 | - | 1149 | WP_001281145.1 | alanine racemase | - |
NW963_RS10365 (NW963_10360) | 2098446..2098805 | - | 360 | WP_000581197.1 | holo-ACP synthase | - |
NW963_RS10370 (NW963_10365) | 2098809..2099300 | - | 492 | WP_001205912.1 | PH domain-containing protein | - |
NW963_RS10375 (NW963_10370) | 2099287..2100870 | - | 1584 | WP_001294620.1 | PH domain-containing protein | - |
NW963_RS10380 (NW963_10375) | 2100863..2101342 | - | 480 | WP_001287079.1 | hypothetical protein | - |
NW963_RS10385 (NW963_10380) | 2101551..2102111 | - | 561 | WP_001092409.1 | K(+)-transporting ATPase subunit C | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 121 a.a. Molecular weight: 13441.69 Da Isoelectric Point: 10.1654
>T254749 WP_000621175.1 NZ_CP102972:c2096980-2096618 [Staphylococcus aureus]
MIRRGDVYLADLSPVQGSEQGGVRPVVIIQNDTGNKYSPTVIVAAITGRINKAKIPTHVEIEKKKYKLDKDSVILLEQIR
TLDKKRLKEKLTYLSDDKMKEVDNALMISLGLNAVAHQKN
MIRRGDVYLADLSPVQGSEQGGVRPVVIIQNDTGNKYSPTVIVAAITGRINKAKIPTHVEIEKKKYKLDKDSVILLEQIR
TLDKKRLKEKLTYLSDDKMKEVDNALMISLGLNAVAHQKN
Download Length: 363 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|