Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | mazEF/MazF(toxin) |
Location | 2051711..2052240 | Replicon | chromosome |
Accession | NZ_CP102971 | ||
Organism | Staphylococcus aureus strain 08-G-E |
Toxin (Protein)
Gene name | mazF | Uniprot ID | - |
Locus tag | NW975_RS10025 | Protein ID | WP_000621175.1 |
Coordinates | 2051711..2052073 (-) | Length | 121 a.a. |
Antitoxin (Protein)
Gene name | mazE | Uniprot ID | T1YCG8 |
Locus tag | NW975_RS10030 | Protein ID | WP_000948331.1 |
Coordinates | 2052070..2052240 (-) | Length | 57 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
NW975_RS10005 (NW975_10005) | 2048689..2049459 | - | 771 | WP_001041107.1 | RNA polymerase sigma factor SigB | - |
NW975_RS10010 (NW975_10010) | 2049434..2049913 | - | 480 | WP_258413936.1 | anti-sigma B factor RsbW | - |
NW975_RS10015 (NW975_10015) | 2049915..2050241 | - | 327 | WP_001052491.1 | anti-sigma factor antagonist | - |
NW975_RS10020 (NW975_10020) | 2050360..2051361 | - | 1002 | WP_000390829.1 | PP2C family protein-serine/threonine phosphatase | - |
NW975_RS10025 (NW975_10025) | 2051711..2052073 | - | 363 | WP_000621175.1 | type II toxin-antitoxin system PemK/MazF family toxin | Toxin |
NW975_RS10030 (NW975_10030) | 2052070..2052240 | - | 171 | WP_000948331.1 | type II toxin-antitoxin system antitoxin MazE | Antitoxin |
NW975_RS10035 (NW975_10035) | 2052325..2053473 | - | 1149 | WP_001281154.1 | alanine racemase | - |
NW975_RS10040 (NW975_10040) | 2053539..2053898 | - | 360 | WP_000581197.1 | holo-ACP synthase | - |
NW975_RS10045 (NW975_10045) | 2053902..2054393 | - | 492 | WP_001205912.1 | PH domain-containing protein | - |
NW975_RS10050 (NW975_10050) | 2054380..2055963 | - | 1584 | WP_258413937.1 | PH domain-containing protein | - |
NW975_RS10055 (NW975_10055) | 2055956..2056435 | - | 480 | WP_001287078.1 | hypothetical protein | - |
NW975_RS10060 (NW975_10060) | 2056644..2057204 | - | 561 | WP_061838823.1 | K(+)-transporting ATPase subunit C | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 121 a.a. Molecular weight: 13441.69 Da Isoelectric Point: 10.1654
>T254741 WP_000621175.1 NZ_CP102971:c2052073-2051711 [Staphylococcus aureus]
MIRRGDVYLADLSPVQGSEQGGVRPVVIIQNDTGNKYSPTVIVAAITGRINKAKIPTHVEIEKKKYKLDKDSVILLEQIR
TLDKKRLKEKLTYLSDDKMKEVDNALMISLGLNAVAHQKN
MIRRGDVYLADLSPVQGSEQGGVRPVVIIQNDTGNKYSPTVIVAAITGRINKAKIPTHVEIEKKKYKLDKDSVILLEQIR
TLDKKRLKEKLTYLSDDKMKEVDNALMISLGLNAVAHQKN
Download Length: 363 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|