Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | tsbAT/- |
Location | 1893369..1894145 | Replicon | chromosome |
Accession | NZ_CP102971 | ||
Organism | Staphylococcus aureus strain 08-G-E |
Toxin (Protein)
Gene name | tsbT | Uniprot ID | X5E2E6 |
Locus tag | NW975_RS09100 | Protein ID | WP_000031108.1 |
Coordinates | 1893369..1893521 (-) | Length | 51 a.a. |
Antitoxin (Protein)
Gene name | tsbA | Uniprot ID | W8U4V4 |
Locus tag | NW975_RS09105 | Protein ID | WP_001251224.1 |
Coordinates | 1893546..1894145 (-) | Length | 200 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
NW975_RS09085 (NW975_09085) | 1889398..1890219 | + | 822 | WP_000669376.1 | RluA family pseudouridine synthase | - |
NW975_RS09090 (NW975_09090) | 1890682..1892067 | - | 1386 | WP_258413920.1 | class II fumarate hydratase | - |
NW975_RS09095 (NW975_09095) | 1892263..1892658 | - | 396 | WP_000901023.1 | hypothetical protein | - |
NW975_RS09100 (NW975_09100) | 1893369..1893521 | - | 153 | WP_000031108.1 | SAS053 family protein | Toxin |
NW975_RS09105 (NW975_09105) | 1893546..1894145 | - | 600 | WP_001251224.1 | glucosamine-6-phosphate isomerase | Antitoxin |
NW975_RS09110 (NW975_09110) | 1894304..1894774 | - | 471 | WP_000181394.1 | tRNA (uridine(34)/cytosine(34)/5- carboxymethylaminomethyluridine(34)-2'-O)- methyltransferase TrmL | - |
NW975_RS09115 (NW975_09115) | 1894779..1895906 | - | 1128 | WP_000379981.1 | tRNA epoxyqueuosine(34) reductase QueG | - |
NW975_RS09120 (NW975_09120) | 1896057..1896779 | - | 723 | WP_000590809.1 | amino acid ABC transporter ATP-binding protein | - |
NW975_RS09125 (NW975_09125) | 1896772..1898229 | - | 1458 | WP_000649908.1 | ABC transporter permease subunit | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Prophage | - | lukD / hlgA / selk | 1832645..1903326 | 70681 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 51 a.a. Molecular weight: 5936.28 Da Isoelectric Point: 3.8962
>T254740 WP_000031108.1 NZ_CP102971:c1893521-1893369 [Staphylococcus aureus]
MSKDKDPKLNYHEEENSMVTDFEDLKELGKEMEQISDQNDQEKNSEEDSQ
MSKDKDPKLNYHEEENSMVTDFEDLKELGKEMEQISDQNDQEKNSEEDSQ
Download Length: 153 bp
Antitoxin
Download Length: 200 a.a. Molecular weight: 22343.47 Da Isoelectric Point: 5.1445
>AT254740 WP_001251224.1 NZ_CP102971:c1894145-1893546 [Staphylococcus aureus]
MAMNFKVFDNSQLVAEYAADIIRKQFNNNPTTIAGFHLDTDQAPVLDELKKNVEKHAVDFSQINILDYDDKKSYFEALGV
PAGQVYPIAYEKDAIELIADKIKTKENKGKLTLQVVSIDEQGKLNVSIRQGLMEAREIFLVVTGANKRDVVEKLYQENGK
TSFEPADLKAHRMVNVILDKEAAAGLPEDVKAYFTSRFA
MAMNFKVFDNSQLVAEYAADIIRKQFNNNPTTIAGFHLDTDQAPVLDELKKNVEKHAVDFSQINILDYDDKKSYFEALGV
PAGQVYPIAYEKDAIELIADKIKTKENKGKLTLQVVSIDEQGKLNVSIRQGLMEAREIFLVVTGANKRDVVEKLYQENGK
TSFEPADLKAHRMVNVILDKEAAAGLPEDVKAYFTSRFA
Download Length: 600 bp
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|