Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) TsaAT/-
Location 814454..814931 Replicon chromosome
Accession NZ_CP102971
Organism Staphylococcus aureus strain 08-G-E

Toxin (Protein)


Gene name TsaT Uniprot ID T1Y7S2
Locus tag NW975_RS03820 Protein ID WP_000052076.1
Coordinates 814454..814642 (-) Length 63 a.a.

Antitoxin (Protein)


Gene name TsaA Uniprot ID T1Y6P8
Locus tag NW975_RS03825 Protein ID WP_001059690.1
Coordinates 814671..814931 (-) Length 87 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
NW975_RS03790 (NW975_03790) 810495..810965 + 471 WP_000824467.1 hypothetical protein -
NW975_RS03795 (NW975_03795) 811306..811992 + 687 WP_072361002.1 thermonuclease family protein -
NW975_RS03800 (NW975_03800) 812349..812549 + 201 WP_001059082.1 cold-shock protein -
NW975_RS03805 (NW975_03805) 813045..813263 - 219 WP_000005886.1 hypothetical protein -
NW975_RS03810 (NW975_03810) 813325..813609 - 285 WP_001004401.1 hypothetical protein -
NW975_RS03815 (NW975_03815) 813697..814266 - 570 WP_001106654.1 lipoprotein N-acylation protein LnsA -
NW975_RS03820 (NW975_03820) 814454..814642 - 189 WP_000052076.1 hypothetical protein Toxin
NW975_RS03825 (NW975_03825) 814671..814931 - 261 WP_001059690.1 hypothetical protein Antitoxin
NW975_RS03830 (NW975_03830) 815271..815474 + 204 WP_000145163.1 sterile alpha motif-like domain-containing protein -
NW975_RS03835 (NW975_03835) 815471..815707 - 237 WP_000368687.1 hypothetical protein -
NW975_RS03840 (NW975_03840) 815932..816513 + 582 WP_001140693.1 histidine phosphatase family protein -
NW975_RS03845 (NW975_03845) 816586..817203 - 618 WP_000255553.1 LysE/ArgO family amino acid transporter -
NW975_RS03850 (NW975_03850) 817359..817853 - 495 WP_000569884.1 GNAT family N-acetyltransferase -
NW975_RS03855 (NW975_03855) 818252..818674 - 423 WP_258414090.1 organic hydroperoxide resistance protein -
NW975_RS03860 (NW975_03860) 818822..819538 + 717 WP_258414091.1 type I 3-dehydroquinate dehydratase -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin


No domain identified.


Antitoxin


No domain identified.



Sequences

Toxin        


Download         Length: 63 a.a.        Molecular weight: 7142.82 Da        Isoelectric Point: 9.9971

>T254738 WP_000052076.1 NZ_CP102971:c814642-814454 [Staphylococcus aureus]
MSLHFAILFWLALIFLVAATFILVLMKKTGKESKKESYLSFTVILYIFGFAILIYTFIFGVL

Download         Length: 189 bp

Antitoxin


Download         Length: 87 a.a.        Molecular weight: 9940.09 Da        Isoelectric Point: 4.0624

>AT254738 WP_001059690.1 NZ_CP102971:c814931-814671 [Staphylococcus aureus]
MNNILLNAINIVITTTFVIFNILITYNKDLDDLCWLLPGIIICGVILIVSFTIAMITKNWLSEILFFINIVLVLYYIYPI
FYSFIG

Download         Length: 261 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A0E0VP18

Antitoxin

Source ID Structure
AlphaFold DB A0A0E0VN56

References