Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | mazEF/MazF(toxin) |
Location | 2054532..2055061 | Replicon | chromosome |
Accession | NZ_CP102970 | ||
Organism | Staphylococcus aureus strain 09-G-F |
Toxin (Protein)
Gene name | mazF | Uniprot ID | - |
Locus tag | NW983_RS10050 | Protein ID | WP_000621175.1 |
Coordinates | 2054532..2054894 (-) | Length | 121 a.a. |
Antitoxin (Protein)
Gene name | mazE | Uniprot ID | T1YCG8 |
Locus tag | NW983_RS10055 | Protein ID | WP_000948331.1 |
Coordinates | 2054891..2055061 (-) | Length | 57 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
NW983_RS10030 (NW983_10030) | 2051510..2052280 | - | 771 | WP_001041107.1 | RNA polymerase sigma factor SigB | - |
NW983_RS10035 (NW983_10035) | 2052255..2052734 | - | 480 | WP_001190825.1 | anti-sigma B factor RsbW | - |
NW983_RS10040 (NW983_10040) | 2052736..2053062 | - | 327 | WP_001052491.1 | anti-sigma factor antagonist | - |
NW983_RS10045 (NW983_10045) | 2053181..2054182 | - | 1002 | WP_000390829.1 | PP2C family protein-serine/threonine phosphatase | - |
NW983_RS10050 (NW983_10050) | 2054532..2054894 | - | 363 | WP_000621175.1 | type II toxin-antitoxin system PemK/MazF family toxin | Toxin |
NW983_RS10055 (NW983_10055) | 2054891..2055061 | - | 171 | WP_000948331.1 | type II toxin-antitoxin system antitoxin MazE | Antitoxin |
NW983_RS10060 (NW983_10060) | 2055146..2056294 | - | 1149 | WP_252570666.1 | alanine racemase | - |
NW983_RS10065 (NW983_10065) | 2056360..2056719 | - | 360 | WP_000581197.1 | holo-ACP synthase | - |
NW983_RS10070 (NW983_10070) | 2056723..2057214 | - | 492 | WP_072353916.1 | PH domain-containing protein | - |
NW983_RS10075 (NW983_10075) | 2057201..2058784 | - | 1584 | WP_045173493.1 | PH domain-containing protein | - |
NW983_RS10080 (NW983_10080) | 2058777..2059256 | - | 480 | WP_258411759.1 | hypothetical protein | - |
NW983_RS10085 (NW983_10085) | 2059465..2060025 | - | 561 | WP_103148787.1 | K(+)-transporting ATPase subunit C | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 121 a.a. Molecular weight: 13441.69 Da Isoelectric Point: 10.1654
>T254730 WP_000621175.1 NZ_CP102970:c2054894-2054532 [Staphylococcus aureus]
MIRRGDVYLADLSPVQGSEQGGVRPVVIIQNDTGNKYSPTVIVAAITGRINKAKIPTHVEIEKKKYKLDKDSVILLEQIR
TLDKKRLKEKLTYLSDDKMKEVDNALMISLGLNAVAHQKN
MIRRGDVYLADLSPVQGSEQGGVRPVVIIQNDTGNKYSPTVIVAAITGRINKAKIPTHVEIEKKKYKLDKDSVILLEQIR
TLDKKRLKEKLTYLSDDKMKEVDNALMISLGLNAVAHQKN
Download Length: 363 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|