Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | tsbAT/- |
| Location | 1902315..1903091 | Replicon | chromosome |
| Accession | NZ_CP102970 | ||
| Organism | Staphylococcus aureus strain 09-G-F | ||
Toxin (Protein)
| Gene name | tsbT | Uniprot ID | X5E2E6 |
| Locus tag | NW983_RS09160 | Protein ID | WP_000031108.1 |
| Coordinates | 1902315..1902467 (-) | Length | 51 a.a. |
Antitoxin (Protein)
| Gene name | tsbA | Uniprot ID | W8U4V4 |
| Locus tag | NW983_RS09165 | Protein ID | WP_001251224.1 |
| Coordinates | 1902492..1903091 (-) | Length | 200 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| NW983_RS09145 (NW983_09145) | 1898045..1898866 | + | 822 | WP_000669376.1 | RluA family pseudouridine synthase | - |
| NW983_RS09150 (NW983_09150) | 1899327..1900712 | - | 1386 | WP_000116231.1 | class II fumarate hydratase | - |
| NW983_RS09155 (NW983_09155) | 1900908..1901303 | - | 396 | WP_000901023.1 | hypothetical protein | - |
| NW983_RS09160 (NW983_09160) | 1902315..1902467 | - | 153 | WP_000031108.1 | SAS053 family protein | Toxin |
| NW983_RS09165 (NW983_09165) | 1902492..1903091 | - | 600 | WP_001251224.1 | glucosamine-6-phosphate isomerase | Antitoxin |
| NW983_RS09170 (NW983_09170) | 1903250..1903720 | - | 471 | WP_258411734.1 | tRNA (uridine(34)/cytosine(34)/5- carboxymethylaminomethyluridine(34)-2'-O)- methyltransferase TrmL | - |
| NW983_RS09175 (NW983_09175) | 1903725..1904852 | - | 1128 | WP_000379980.1 | tRNA epoxyqueuosine(34) reductase QueG | - |
| NW983_RS09180 (NW983_09180) | 1905003..1905725 | - | 723 | WP_000590809.1 | amino acid ABC transporter ATP-binding protein | - |
| NW983_RS09185 (NW983_09185) | 1905718..1907175 | - | 1458 | WP_258411735.1 | ABC transporter permease subunit | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 51 a.a. Molecular weight: 5936.28 Da Isoelectric Point: 3.8962
>T254729 WP_000031108.1 NZ_CP102970:c1902467-1902315 [Staphylococcus aureus]
MSKDKDPKLNYHEEENSMVTDFEDLKELGKEMEQISDQNDQEKNSEEDSQ
MSKDKDPKLNYHEEENSMVTDFEDLKELGKEMEQISDQNDQEKNSEEDSQ
Download Length: 153 bp
Antitoxin
Download Length: 200 a.a. Molecular weight: 22343.47 Da Isoelectric Point: 5.1445
>AT254729 WP_001251224.1 NZ_CP102970:c1903091-1902492 [Staphylococcus aureus]
MAMNFKVFDNSQLVAEYAADIIRKQFNNNPTTIAGFHLDTDQAPVLDELKKNVEKHAVDFSQINILDYDDKKSYFEALGV
PAGQVYPIAYEKDAIELIADKIKTKENKGKLTLQVVSIDEQGKLNVSIRQGLMEAREIFLVVTGANKRDVVEKLYQENGK
TSFEPADLKAHRMVNVILDKEAAAGLPEDVKAYFTSRFA
MAMNFKVFDNSQLVAEYAADIIRKQFNNNPTTIAGFHLDTDQAPVLDELKKNVEKHAVDFSQINILDYDDKKSYFEALGV
PAGQVYPIAYEKDAIELIADKIKTKENKGKLTLQVVSIDEQGKLNVSIRQGLMEAREIFLVVTGANKRDVVEKLYQENGK
TSFEPADLKAHRMVNVILDKEAAAGLPEDVKAYFTSRFA
Download Length: 600 bp
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|