Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) TsaAT/-
Location 827679..828156 Replicon chromosome
Accession NZ_CP102970
Organism Staphylococcus aureus strain 09-G-F

Toxin (Protein)


Gene name TsaT Uniprot ID T1Y7S2
Locus tag NW983_RS03915 Protein ID WP_000052076.1
Coordinates 827679..827867 (-) Length 63 a.a.

Antitoxin (Protein)


Gene name TsaA Uniprot ID T1Y6P8
Locus tag NW983_RS03920 Protein ID WP_001059690.1
Coordinates 827896..828156 (-) Length 87 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
NW983_RS03885 (NW983_03885) 823670..824191 + 522 WP_000824484.1 hypothetical protein -
NW983_RS03890 (NW983_03890) 824532..825218 + 687 WP_001793574.1 thermonuclease family protein -
NW983_RS03895 (NW983_03895) 825575..825775 + 201 WP_001059082.1 cold-shock protein -
NW983_RS03900 (NW983_03900) 826270..826488 - 219 WP_000005884.1 hypothetical protein -
NW983_RS03905 (NW983_03905) 826550..826834 - 285 WP_001004394.1 hypothetical protein -
NW983_RS03910 (NW983_03910) 826922..827491 - 570 WP_072497911.1 lipoprotein N-acylation protein LnsA -
NW983_RS03915 (NW983_03915) 827679..827867 - 189 WP_000052076.1 hypothetical protein Toxin
NW983_RS03920 (NW983_03920) 827896..828156 - 261 WP_001059690.1 hypothetical protein Antitoxin
NW983_RS03925 (NW983_03925) 828497..828700 + 204 WP_000145163.1 sterile alpha motif-like domain-containing protein -
NW983_RS03930 (NW983_03930) 828697..828933 - 237 WP_000368687.1 hypothetical protein -
NW983_RS03935 (NW983_03935) 829158..829739 + 582 WP_001140693.1 histidine phosphatase family protein -
NW983_RS03940 (NW983_03940) 829812..830429 - 618 WP_000255561.1 LysE/ArgO family amino acid transporter -
NW983_RS03945 (NW983_03945) 830517..832163 - 1647 WP_040968626.1 IS1182 family transposase -
NW983_RS03950 (NW983_03950) 832503..832997 - 495 WP_000569884.1 GNAT family N-acetyltransferase -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- flank IS/Tn - - 830517..832163 1646


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin


No domain identified.


Antitoxin


No domain identified.



Sequences

Toxin        


Download         Length: 63 a.a.        Molecular weight: 7142.82 Da        Isoelectric Point: 9.9971

>T254727 WP_000052076.1 NZ_CP102970:c827867-827679 [Staphylococcus aureus]
MSLHFAILFWLALIFLVAATFILVLMKKTGKESKKESYLSFTVILYIFGFAILIYTFIFGVL

Download         Length: 189 bp

Antitoxin


Download         Length: 87 a.a.        Molecular weight: 9940.09 Da        Isoelectric Point: 4.0624

>AT254727 WP_001059690.1 NZ_CP102970:c828156-827896 [Staphylococcus aureus]
MNNILLNAINIVITTTFVIFNILITYNKDLDDLCWLLPGIIICGVILIVSFTIAMITKNWLSEILFFINIVLVLYYIYPI
FYSFIG

Download         Length: 261 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A0E0VP18

Antitoxin

Source ID Structure
AlphaFold DB A0A0E0VN56

References