Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | mazEF/MazF(toxin) |
| Location | 2026036..2026565 | Replicon | chromosome |
| Accession | NZ_CP102968 | ||
| Organism | Staphylococcus aureus strain 13-G-52 | ||
Toxin (Protein)
| Gene name | mazF | Uniprot ID | - |
| Locus tag | NW965_RS09825 | Protein ID | WP_000621175.1 |
| Coordinates | 2026036..2026398 (-) | Length | 121 a.a. |
Antitoxin (Protein)
| Gene name | mazE | Uniprot ID | T1YCG8 |
| Locus tag | NW965_RS09830 | Protein ID | WP_000948331.1 |
| Coordinates | 2026395..2026565 (-) | Length | 57 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| NW965_RS09805 (NW965_09805) | 2023014..2023784 | - | 771 | WP_001041107.1 | RNA polymerase sigma factor SigB | - |
| NW965_RS09810 (NW965_09810) | 2023759..2024238 | - | 480 | WP_258413936.1 | anti-sigma B factor RsbW | - |
| NW965_RS09815 (NW965_09815) | 2024240..2024566 | - | 327 | WP_001052491.1 | anti-sigma factor antagonist | - |
| NW965_RS09820 (NW965_09820) | 2024685..2025686 | - | 1002 | WP_000390829.1 | PP2C family protein-serine/threonine phosphatase | - |
| NW965_RS09825 (NW965_09825) | 2026036..2026398 | - | 363 | WP_000621175.1 | type II toxin-antitoxin system PemK/MazF family toxin | Toxin |
| NW965_RS09830 (NW965_09830) | 2026395..2026565 | - | 171 | WP_000948331.1 | type II toxin-antitoxin system antitoxin MazE | Antitoxin |
| NW965_RS09835 (NW965_09835) | 2026650..2027798 | - | 1149 | WP_001281154.1 | alanine racemase | - |
| NW965_RS09840 (NW965_09840) | 2027864..2028223 | - | 360 | WP_000581197.1 | holo-ACP synthase | - |
| NW965_RS09845 (NW965_09845) | 2028227..2028718 | - | 492 | WP_001205912.1 | PH domain-containing protein | - |
| NW965_RS09850 (NW965_09850) | 2028705..2030288 | - | 1584 | WP_258413937.1 | PH domain-containing protein | - |
| NW965_RS09855 (NW965_09855) | 2030281..2030760 | - | 480 | WP_001287078.1 | hypothetical protein | - |
| NW965_RS09860 (NW965_09860) | 2030969..2031529 | - | 561 | WP_061838823.1 | K(+)-transporting ATPase subunit C | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 121 a.a. Molecular weight: 13441.69 Da Isoelectric Point: 10.1654
>T254721 WP_000621175.1 NZ_CP102968:c2026398-2026036 [Staphylococcus aureus]
MIRRGDVYLADLSPVQGSEQGGVRPVVIIQNDTGNKYSPTVIVAAITGRINKAKIPTHVEIEKKKYKLDKDSVILLEQIR
TLDKKRLKEKLTYLSDDKMKEVDNALMISLGLNAVAHQKN
MIRRGDVYLADLSPVQGSEQGGVRPVVIIQNDTGNKYSPTVIVAAITGRINKAKIPTHVEIEKKKYKLDKDSVILLEQIR
TLDKKRLKEKLTYLSDDKMKEVDNALMISLGLNAVAHQKN
Download Length: 363 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|