Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | tsbAT/- |
Location | 1862319..1863095 | Replicon | chromosome |
Accession | NZ_CP102968 | ||
Organism | Staphylococcus aureus strain 13-G-52 |
Toxin (Protein)
Gene name | tsbT | Uniprot ID | X5E2E6 |
Locus tag | NW965_RS08875 | Protein ID | WP_000031108.1 |
Coordinates | 1862319..1862471 (-) | Length | 51 a.a. |
Antitoxin (Protein)
Gene name | tsbA | Uniprot ID | W8U4V4 |
Locus tag | NW965_RS08880 | Protein ID | WP_001251224.1 |
Coordinates | 1862496..1863095 (-) | Length | 200 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
NW965_RS08860 (NW965_08860) | 1858348..1859169 | + | 822 | WP_000669376.1 | RluA family pseudouridine synthase | - |
NW965_RS08865 (NW965_08865) | 1859632..1861017 | - | 1386 | WP_258413920.1 | class II fumarate hydratase | - |
NW965_RS08870 (NW965_08870) | 1861213..1861608 | - | 396 | WP_000901023.1 | hypothetical protein | - |
NW965_RS08875 (NW965_08875) | 1862319..1862471 | - | 153 | WP_000031108.1 | SAS053 family protein | Toxin |
NW965_RS08880 (NW965_08880) | 1862496..1863095 | - | 600 | WP_001251224.1 | glucosamine-6-phosphate isomerase | Antitoxin |
NW965_RS08885 (NW965_08885) | 1863254..1863724 | - | 471 | WP_000181394.1 | tRNA (uridine(34)/cytosine(34)/5- carboxymethylaminomethyluridine(34)-2'-O)- methyltransferase TrmL | - |
NW965_RS08890 (NW965_08890) | 1863729..1864856 | - | 1128 | WP_000379981.1 | tRNA epoxyqueuosine(34) reductase QueG | - |
NW965_RS08895 (NW965_08895) | 1865007..1865729 | - | 723 | WP_000590809.1 | amino acid ABC transporter ATP-binding protein | - |
NW965_RS08900 (NW965_08900) | 1865722..1867179 | - | 1458 | WP_000649908.1 | ABC transporter permease subunit | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 51 a.a. Molecular weight: 5936.28 Da Isoelectric Point: 3.8962
>T254720 WP_000031108.1 NZ_CP102968:c1862471-1862319 [Staphylococcus aureus]
MSKDKDPKLNYHEEENSMVTDFEDLKELGKEMEQISDQNDQEKNSEEDSQ
MSKDKDPKLNYHEEENSMVTDFEDLKELGKEMEQISDQNDQEKNSEEDSQ
Download Length: 153 bp
Antitoxin
Download Length: 200 a.a. Molecular weight: 22343.47 Da Isoelectric Point: 5.1445
>AT254720 WP_001251224.1 NZ_CP102968:c1863095-1862496 [Staphylococcus aureus]
MAMNFKVFDNSQLVAEYAADIIRKQFNNNPTTIAGFHLDTDQAPVLDELKKNVEKHAVDFSQINILDYDDKKSYFEALGV
PAGQVYPIAYEKDAIELIADKIKTKENKGKLTLQVVSIDEQGKLNVSIRQGLMEAREIFLVVTGANKRDVVEKLYQENGK
TSFEPADLKAHRMVNVILDKEAAAGLPEDVKAYFTSRFA
MAMNFKVFDNSQLVAEYAADIIRKQFNNNPTTIAGFHLDTDQAPVLDELKKNVEKHAVDFSQINILDYDDKKSYFEALGV
PAGQVYPIAYEKDAIELIADKIKTKENKGKLTLQVVSIDEQGKLNVSIRQGLMEAREIFLVVTGANKRDVVEKLYQENGK
TSFEPADLKAHRMVNVILDKEAAAGLPEDVKAYFTSRFA
Download Length: 600 bp
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|