Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | mazEF/MazF(toxin) |
| Location | 2059923..2060452 | Replicon | chromosome |
| Accession | NZ_CP102967 | ||
| Organism | Staphylococcus aureus strain 17-H-61 | ||
Toxin (Protein)
| Gene name | mazF | Uniprot ID | - |
| Locus tag | NW947_RS10115 | Protein ID | WP_000621175.1 |
| Coordinates | 2059923..2060285 (-) | Length | 121 a.a. |
Antitoxin (Protein)
| Gene name | mazE | Uniprot ID | T1YCG8 |
| Locus tag | NW947_RS10120 | Protein ID | WP_000948331.1 |
| Coordinates | 2060282..2060452 (-) | Length | 57 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| NW947_RS10095 (NW947_10095) | 2056901..2057671 | - | 771 | WP_001041102.1 | RNA polymerase sigma factor SigB | - |
| NW947_RS10100 (NW947_10100) | 2057646..2058125 | - | 480 | WP_001190829.1 | anti-sigma B factor RsbW | - |
| NW947_RS10105 (NW947_10105) | 2058127..2058453 | - | 327 | WP_001052491.1 | anti-sigma factor antagonist | - |
| NW947_RS10110 (NW947_10110) | 2058572..2059573 | - | 1002 | WP_000390829.1 | PP2C family protein-serine/threonine phosphatase | - |
| NW947_RS10115 (NW947_10115) | 2059923..2060285 | - | 363 | WP_000621175.1 | type II toxin-antitoxin system PemK/MazF family toxin | Toxin |
| NW947_RS10120 (NW947_10120) | 2060282..2060452 | - | 171 | WP_000948331.1 | type II toxin-antitoxin system antitoxin MazE | Antitoxin |
| NW947_RS10125 (NW947_10125) | 2060537..2061685 | - | 1149 | WP_001281154.1 | alanine racemase | - |
| NW947_RS10130 (NW947_10130) | 2061751..2062110 | - | 360 | WP_000581197.1 | holo-ACP synthase | - |
| NW947_RS10135 (NW947_10135) | 2062114..2062605 | - | 492 | WP_001205912.1 | PH domain-containing protein | - |
| NW947_RS10140 (NW947_10140) | 2062592..2064175 | - | 1584 | WP_258416268.1 | PH domain-containing protein | - |
| NW947_RS10145 (NW947_10145) | 2064168..2064647 | - | 480 | WP_001287079.1 | hypothetical protein | - |
| NW947_RS10150 (NW947_10150) | 2064856..2065416 | - | 561 | WP_001092409.1 | K(+)-transporting ATPase subunit C | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 121 a.a. Molecular weight: 13441.69 Da Isoelectric Point: 10.1654
>T254713 WP_000621175.1 NZ_CP102967:c2060285-2059923 [Staphylococcus aureus]
MIRRGDVYLADLSPVQGSEQGGVRPVVIIQNDTGNKYSPTVIVAAITGRINKAKIPTHVEIEKKKYKLDKDSVILLEQIR
TLDKKRLKEKLTYLSDDKMKEVDNALMISLGLNAVAHQKN
MIRRGDVYLADLSPVQGSEQGGVRPVVIIQNDTGNKYSPTVIVAAITGRINKAKIPTHVEIEKKKYKLDKDSVILLEQIR
TLDKKRLKEKLTYLSDDKMKEVDNALMISLGLNAVAHQKN
Download Length: 363 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|