Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | tsbAT/- |
Location | 1906255..1907031 | Replicon | chromosome |
Accession | NZ_CP102967 | ||
Organism | Staphylococcus aureus strain 17-H-61 |
Toxin (Protein)
Gene name | tsbT | Uniprot ID | X5E2E6 |
Locus tag | NW947_RS09225 | Protein ID | WP_000031108.1 |
Coordinates | 1906255..1906407 (-) | Length | 51 a.a. |
Antitoxin (Protein)
Gene name | tsbA | Uniprot ID | W8U4V4 |
Locus tag | NW947_RS09230 | Protein ID | WP_001251224.1 |
Coordinates | 1906432..1907031 (-) | Length | 200 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
NW947_RS09210 (NW947_09210) | 1902276..1903097 | + | 822 | WP_045174097.1 | RluA family pseudouridine synthase | - |
NW947_RS09215 (NW947_09215) | 1903560..1904945 | - | 1386 | WP_045174099.1 | class II fumarate hydratase | - |
NW947_RS09220 (NW947_09220) | 1905141..1905536 | - | 396 | WP_000901023.1 | hypothetical protein | - |
NW947_RS09225 (NW947_09225) | 1906255..1906407 | - | 153 | WP_000031108.1 | SAS053 family protein | Toxin |
NW947_RS09230 (NW947_09230) | 1906432..1907031 | - | 600 | WP_001251224.1 | glucosamine-6-phosphate isomerase | Antitoxin |
NW947_RS09235 (NW947_09235) | 1907189..1907659 | - | 471 | WP_000181394.1 | tRNA (uridine(34)/cytosine(34)/5- carboxymethylaminomethyluridine(34)-2'-O)- methyltransferase TrmL | - |
NW947_RS09240 (NW947_09240) | 1907664..1908791 | - | 1128 | WP_000379985.1 | tRNA epoxyqueuosine(34) reductase QueG | - |
NW947_RS09245 (NW947_09245) | 1908942..1909664 | - | 723 | WP_000590809.1 | amino acid ABC transporter ATP-binding protein | - |
NW947_RS09250 (NW947_09250) | 1909657..1911114 | - | 1458 | WP_000649907.1 | ABC transporter permease subunit | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 51 a.a. Molecular weight: 5936.28 Da Isoelectric Point: 3.8962
>T254712 WP_000031108.1 NZ_CP102967:c1906407-1906255 [Staphylococcus aureus]
MSKDKDPKLNYHEEENSMVTDFEDLKELGKEMEQISDQNDQEKNSEEDSQ
MSKDKDPKLNYHEEENSMVTDFEDLKELGKEMEQISDQNDQEKNSEEDSQ
Download Length: 153 bp
Antitoxin
Download Length: 200 a.a. Molecular weight: 22343.47 Da Isoelectric Point: 5.1445
>AT254712 WP_001251224.1 NZ_CP102967:c1907031-1906432 [Staphylococcus aureus]
MAMNFKVFDNSQLVAEYAADIIRKQFNNNPTTIAGFHLDTDQAPVLDELKKNVEKHAVDFSQINILDYDDKKSYFEALGV
PAGQVYPIAYEKDAIELIADKIKTKENKGKLTLQVVSIDEQGKLNVSIRQGLMEAREIFLVVTGANKRDVVEKLYQENGK
TSFEPADLKAHRMVNVILDKEAAAGLPEDVKAYFTSRFA
MAMNFKVFDNSQLVAEYAADIIRKQFNNNPTTIAGFHLDTDQAPVLDELKKNVEKHAVDFSQINILDYDDKKSYFEALGV
PAGQVYPIAYEKDAIELIADKIKTKENKGKLTLQVVSIDEQGKLNVSIRQGLMEAREIFLVVTGANKRDVVEKLYQENGK
TSFEPADLKAHRMVNVILDKEAAAGLPEDVKAYFTSRFA
Download Length: 600 bp
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|