Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) TsaAT/-
Location 820866..821343 Replicon chromosome
Accession NZ_CP102967
Organism Staphylococcus aureus strain 17-H-61

Toxin (Protein)


Gene name TsaT Uniprot ID -
Locus tag NW947_RS03885 Protein ID WP_258416643.1
Coordinates 820866..821054 (-) Length 63 a.a.

Antitoxin (Protein)


Gene name TsaA Uniprot ID T1Y6P8
Locus tag NW947_RS03890 Protein ID WP_001059690.1
Coordinates 821083..821343 (-) Length 87 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
NW947_RS03855 (NW947_03855) 816857..817378 + 522 WP_000824487.1 hypothetical protein -
NW947_RS03860 (NW947_03860) 817719..818405 + 687 WP_072361002.1 thermonuclease family protein -
NW947_RS03865 (NW947_03865) 818762..818962 + 201 WP_001059082.1 cold-shock protein -
NW947_RS03870 (NW947_03870) 819457..819660 - 204 WP_258416803.1 hypothetical protein -
NW947_RS03875 (NW947_03875) 819737..820021 - 285 WP_001004399.1 hypothetical protein -
NW947_RS03880 (NW947_03880) 820109..820678 - 570 WP_072497911.1 lipoprotein N-acylation protein LnsA -
NW947_RS03885 (NW947_03885) 820866..821054 - 189 WP_258416643.1 hypothetical protein Toxin
NW947_RS03890 (NW947_03890) 821083..821343 - 261 WP_001059690.1 hypothetical protein Antitoxin
NW947_RS03895 (NW947_03895) 821684..821887 + 204 WP_000145164.1 sterile alpha motif-like domain-containing protein -
NW947_RS03900 (NW947_03900) 821884..822120 - 237 WP_000368687.1 hypothetical protein -
NW947_RS03905 (NW947_03905) 822345..822926 + 582 WP_001140693.1 histidine phosphatase family protein -
NW947_RS03910 (NW947_03910) 822999..823616 - 618 WP_000255561.1 LysE/ArgO family amino acid transporter -
NW947_RS03915 (NW947_03915) 823771..824265 - 495 WP_000569884.1 GNAT family N-acetyltransferase -
NW947_RS03920 (NW947_03920) 824664..825086 - 423 WP_000974460.1 organic hydroperoxide resistance protein -
NW947_RS03925 (NW947_03925) 825234..825950 + 717 WP_000150020.1 type I 3-dehydroquinate dehydratase -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin


No domain identified.


Antitoxin


No domain identified.



Sequences

Toxin        


Download         Length: 63 a.a.        Molecular weight: 7142.82 Da        Isoelectric Point: 9.9971

>T254711 WP_258416643.1 NZ_CP102967:c821054-820866 [Staphylococcus aureus]
MSLHFAILFWLALIFIVAATFILVLMKKTGKESKKESYLSFTVILYIFGFAILIYTFIFGVL

Download         Length: 189 bp

Antitoxin


Download         Length: 87 a.a.        Molecular weight: 9940.09 Da        Isoelectric Point: 4.0624

>AT254711 WP_001059690.1 NZ_CP102967:c821343-821083 [Staphylococcus aureus]
MNNILLNAINIVITTTFVIFNILITYNKDLDDLCWLLPGIIICGVILIVSFTIAMITKNWLSEILFFINIVLVLYYIYPI
FYSFIG

Download         Length: 261 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure

Antitoxin

Source ID Structure
AlphaFold DB A0A0E0VN56

References