Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | mazEF/MazF(toxin) |
Location | 2064694..2065223 | Replicon | chromosome |
Accession | NZ_CP102966 | ||
Organism | Staphylococcus aureus strain 29-P-01 |
Toxin (Protein)
Gene name | mazF | Uniprot ID | - |
Locus tag | NW955_RS10145 | Protein ID | WP_000621175.1 |
Coordinates | 2064694..2065056 (-) | Length | 121 a.a. |
Antitoxin (Protein)
Gene name | mazE | Uniprot ID | T1YCG8 |
Locus tag | NW955_RS10150 | Protein ID | WP_000948331.1 |
Coordinates | 2065053..2065223 (-) | Length | 57 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
NW955_RS10125 (NW955_10125) | 2061673..2062443 | - | 771 | WP_001041107.1 | RNA polymerase sigma factor SigB | - |
NW955_RS10130 (NW955_10130) | 2062418..2062897 | - | 480 | WP_001190825.1 | anti-sigma B factor RsbW | - |
NW955_RS10135 (NW955_10135) | 2062899..2063225 | - | 327 | WP_001052491.1 | anti-sigma factor antagonist | - |
NW955_RS10140 (NW955_10140) | 2063344..2064345 | - | 1002 | WP_000390829.1 | PP2C family protein-serine/threonine phosphatase | - |
NW955_RS10145 (NW955_10145) | 2064694..2065056 | - | 363 | WP_000621175.1 | type II toxin-antitoxin system PemK/MazF family toxin | Toxin |
NW955_RS10150 (NW955_10150) | 2065053..2065223 | - | 171 | WP_000948331.1 | type II toxin-antitoxin system antitoxin MazE | Antitoxin |
NW955_RS10155 (NW955_10155) | 2065308..2066456 | - | 1149 | WP_001281145.1 | alanine racemase | - |
NW955_RS10160 (NW955_10160) | 2066522..2066881 | - | 360 | WP_000581197.1 | holo-ACP synthase | - |
NW955_RS10165 (NW955_10165) | 2066885..2067376 | - | 492 | WP_072353916.1 | PH domain-containing protein | - |
NW955_RS10170 (NW955_10170) | 2067363..2068946 | - | 1584 | WP_045173493.1 | PH domain-containing protein | - |
NW955_RS10175 (NW955_10175) | 2068939..2069418 | - | 480 | WP_258411759.1 | hypothetical protein | - |
NW955_RS10180 (NW955_10180) | 2069627..2070187 | - | 561 | WP_103148787.1 | K(+)-transporting ATPase subunit C | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 121 a.a. Molecular weight: 13441.69 Da Isoelectric Point: 10.1654
>T254705 WP_000621175.1 NZ_CP102966:c2065056-2064694 [Staphylococcus aureus]
MIRRGDVYLADLSPVQGSEQGGVRPVVIIQNDTGNKYSPTVIVAAITGRINKAKIPTHVEIEKKKYKLDKDSVILLEQIR
TLDKKRLKEKLTYLSDDKMKEVDNALMISLGLNAVAHQKN
MIRRGDVYLADLSPVQGSEQGGVRPVVIIQNDTGNKYSPTVIVAAITGRINKAKIPTHVEIEKKKYKLDKDSVILLEQIR
TLDKKRLKEKLTYLSDDKMKEVDNALMISLGLNAVAHQKN
Download Length: 363 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|