Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | tsbAT/- |
Location | 1904025..1904801 | Replicon | chromosome |
Accession | NZ_CP102966 | ||
Organism | Staphylococcus aureus strain 29-P-01 |
Toxin (Protein)
Gene name | tsbT | Uniprot ID | X5E2E6 |
Locus tag | NW955_RS09220 | Protein ID | WP_000031108.1 |
Coordinates | 1904025..1904177 (-) | Length | 51 a.a. |
Antitoxin (Protein)
Gene name | tsbA | Uniprot ID | W8U4V4 |
Locus tag | NW955_RS09225 | Protein ID | WP_001251224.1 |
Coordinates | 1904202..1904801 (-) | Length | 200 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
NW955_RS09205 (NW955_09205) | 1900046..1900867 | + | 822 | WP_045174097.1 | RluA family pseudouridine synthase | - |
NW955_RS09210 (NW955_09210) | 1901330..1902715 | - | 1386 | WP_045174099.1 | class II fumarate hydratase | - |
NW955_RS09215 (NW955_09215) | 1902911..1903306 | - | 396 | WP_000901023.1 | hypothetical protein | - |
NW955_RS09220 (NW955_09220) | 1904025..1904177 | - | 153 | WP_000031108.1 | SAS053 family protein | Toxin |
NW955_RS09225 (NW955_09225) | 1904202..1904801 | - | 600 | WP_001251224.1 | glucosamine-6-phosphate isomerase | Antitoxin |
NW955_RS09230 (NW955_09230) | 1904959..1905429 | - | 471 | WP_000181394.1 | tRNA (uridine(34)/cytosine(34)/5- carboxymethylaminomethyluridine(34)-2'-O)- methyltransferase TrmL | - |
NW955_RS09235 (NW955_09235) | 1905434..1906561 | - | 1128 | WP_000379985.1 | tRNA epoxyqueuosine(34) reductase QueG | - |
NW955_RS09240 (NW955_09240) | 1906712..1907434 | - | 723 | WP_000590809.1 | amino acid ABC transporter ATP-binding protein | - |
NW955_RS09245 (NW955_09245) | 1907427..1908884 | - | 1458 | WP_000649907.1 | ABC transporter permease subunit | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Prophage | - | lukD / hlgA | 1824738..1913981 | 89243 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 51 a.a. Molecular weight: 5936.28 Da Isoelectric Point: 3.8962
>T254704 WP_000031108.1 NZ_CP102966:c1904177-1904025 [Staphylococcus aureus]
MSKDKDPKLNYHEEENSMVTDFEDLKELGKEMEQISDQNDQEKNSEEDSQ
MSKDKDPKLNYHEEENSMVTDFEDLKELGKEMEQISDQNDQEKNSEEDSQ
Download Length: 153 bp
Antitoxin
Download Length: 200 a.a. Molecular weight: 22343.47 Da Isoelectric Point: 5.1445
>AT254704 WP_001251224.1 NZ_CP102966:c1904801-1904202 [Staphylococcus aureus]
MAMNFKVFDNSQLVAEYAADIIRKQFNNNPTTIAGFHLDTDQAPVLDELKKNVEKHAVDFSQINILDYDDKKSYFEALGV
PAGQVYPIAYEKDAIELIADKIKTKENKGKLTLQVVSIDEQGKLNVSIRQGLMEAREIFLVVTGANKRDVVEKLYQENGK
TSFEPADLKAHRMVNVILDKEAAAGLPEDVKAYFTSRFA
MAMNFKVFDNSQLVAEYAADIIRKQFNNNPTTIAGFHLDTDQAPVLDELKKNVEKHAVDFSQINILDYDDKKSYFEALGV
PAGQVYPIAYEKDAIELIADKIKTKENKGKLTLQVVSIDEQGKLNVSIRQGLMEAREIFLVVTGANKRDVVEKLYQENGK
TSFEPADLKAHRMVNVILDKEAAAGLPEDVKAYFTSRFA
Download Length: 600 bp
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|