Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | mazEF/MazF(toxin) |
| Location | 2100883..2101412 | Replicon | chromosome |
| Accession | NZ_CP102963 | ||
| Organism | Staphylococcus aureus strain 40-B-50 | ||
Toxin (Protein)
| Gene name | mazF | Uniprot ID | - |
| Locus tag | NW941_RS10370 | Protein ID | WP_000621175.1 |
| Coordinates | 2100883..2101245 (-) | Length | 121 a.a. |
Antitoxin (Protein)
| Gene name | mazE | Uniprot ID | T1YCG8 |
| Locus tag | NW941_RS10375 | Protein ID | WP_000948331.1 |
| Coordinates | 2101242..2101412 (-) | Length | 57 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| NW941_RS10350 (NW941_10385) | 2097861..2098631 | - | 771 | WP_001041107.1 | RNA polymerase sigma factor SigB | - |
| NW941_RS10355 (NW941_10390) | 2098606..2099085 | - | 480 | WP_001190829.1 | anti-sigma B factor RsbW | - |
| NW941_RS10360 (NW941_10395) | 2099087..2099413 | - | 327 | WP_001052491.1 | anti-sigma factor antagonist | - |
| NW941_RS10365 (NW941_10400) | 2099532..2100533 | - | 1002 | WP_000390829.1 | PP2C family protein-serine/threonine phosphatase | - |
| NW941_RS10370 (NW941_10405) | 2100883..2101245 | - | 363 | WP_000621175.1 | type II toxin-antitoxin system PemK/MazF family toxin | Toxin |
| NW941_RS10375 (NW941_10410) | 2101242..2101412 | - | 171 | WP_000948331.1 | type II toxin-antitoxin system antitoxin MazE | Antitoxin |
| NW941_RS10380 (NW941_10415) | 2101497..2102645 | - | 1149 | WP_001281151.1 | alanine racemase | - |
| NW941_RS10385 (NW941_10420) | 2102711..2103070 | - | 360 | WP_000581200.1 | holo-ACP synthase | - |
| NW941_RS10390 (NW941_10425) | 2103074..2103565 | - | 492 | WP_001205910.1 | PH domain-containing protein | - |
| NW941_RS10395 (NW941_10430) | 2103552..2105135 | - | 1584 | WP_001294620.1 | PH domain-containing protein | - |
| NW941_RS10400 (NW941_10435) | 2105128..2105607 | - | 480 | WP_001287079.1 | hypothetical protein | - |
| NW941_RS10405 (NW941_10440) | 2105816..2106376 | - | 561 | WP_258415057.1 | K(+)-transporting ATPase subunit C | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 121 a.a. Molecular weight: 13441.69 Da Isoelectric Point: 10.1654
>T254693 WP_000621175.1 NZ_CP102963:c2101245-2100883 [Staphylococcus aureus]
MIRRGDVYLADLSPVQGSEQGGVRPVVIIQNDTGNKYSPTVIVAAITGRINKAKIPTHVEIEKKKYKLDKDSVILLEQIR
TLDKKRLKEKLTYLSDDKMKEVDNALMISLGLNAVAHQKN
MIRRGDVYLADLSPVQGSEQGGVRPVVIIQNDTGNKYSPTVIVAAITGRINKAKIPTHVEIEKKKYKLDKDSVILLEQIR
TLDKKRLKEKLTYLSDDKMKEVDNALMISLGLNAVAHQKN
Download Length: 363 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|