Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) TsaAT/-
Location 813388..813865 Replicon chromosome
Accession NZ_CP102963
Organism Staphylococcus aureus strain 40-B-50

Toxin (Protein)


Gene name TsaT Uniprot ID T1Y7S2
Locus tag NW941_RS03800 Protein ID WP_000052076.1
Coordinates 813388..813576 (-) Length 63 a.a.

Antitoxin (Protein)


Gene name TsaA Uniprot ID T1Y6P8
Locus tag NW941_RS03805 Protein ID WP_001059690.1
Coordinates 813605..813865 (-) Length 87 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
NW941_RS03770 (NW941_03785) 809342..809899 + 558 WP_258412467.1 hypothetical protein -
NW941_RS03775 (NW941_03790) 810240..810926 + 687 WP_258413292.1 thermonuclease family protein -
NW941_RS03780 (NW941_03795) 811283..811483 + 201 WP_001059082.1 cold-shock protein -
NW941_RS03785 (NW941_03800) 811979..812197 - 219 WP_000005876.1 hypothetical protein -
NW941_RS03790 (NW941_03805) 812259..812543 - 285 WP_001004394.1 hypothetical protein -
NW941_RS03795 (NW941_03810) 812631..813200 - 570 WP_001106652.1 lipoprotein N-acylation protein LnsA -
NW941_RS03800 (NW941_03815) 813388..813576 - 189 WP_000052076.1 hypothetical protein Toxin
NW941_RS03805 (NW941_03820) 813605..813865 - 261 WP_001059690.1 hypothetical protein Antitoxin
NW941_RS03810 (NW941_03825) 814206..814409 + 204 WP_000145163.1 sterile alpha motif-like domain-containing protein -
NW941_RS03815 (NW941_03830) 814406..814642 - 237 WP_000368687.1 hypothetical protein -
NW941_RS03820 (NW941_03835) 814867..815448 + 582 WP_001140697.1 histidine phosphatase family protein -
NW941_RS03825 (NW941_03840) 815521..816138 - 618 WP_086153000.1 LysE/ArgO family amino acid transporter -
NW941_RS03830 (NW941_03845) 816293..816787 - 495 WP_086153001.1 GNAT family N-acetyltransferase -
NW941_RS03835 (NW941_03850) 817185..817607 - 423 WP_000974455.1 organic hydroperoxide resistance protein -
NW941_RS03840 (NW941_03855) 817755..818471 + 717 WP_000150012.1 type I 3-dehydroquinate dehydratase -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin


No domain identified.


Antitoxin


No domain identified.



Sequences

Toxin        


Download         Length: 63 a.a.        Molecular weight: 7142.82 Da        Isoelectric Point: 9.9971

>T254688 WP_000052076.1 NZ_CP102963:c813576-813388 [Staphylococcus aureus]
MSLHFAILFWLALIFLVAATFILVLMKKTGKESKKESYLSFTVILYIFGFAILIYTFIFGVL

Download         Length: 189 bp

Antitoxin


Download         Length: 87 a.a.        Molecular weight: 9940.09 Da        Isoelectric Point: 4.0624

>AT254688 WP_001059690.1 NZ_CP102963:c813865-813605 [Staphylococcus aureus]
MNNILLNAINIVITTTFVIFNILITYNKDLDDLCWLLPGIIICGVILIVSFTIAMITKNWLSEILFFINIVLVLYYIYPI
FYSFIG

Download         Length: 261 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A0E0VP18

Antitoxin

Source ID Structure
AlphaFold DB A0A0E0VN56

References