Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | mazEF/MazF(toxin) |
Location | 2136231..2136760 | Replicon | chromosome |
Accession | NZ_CP102962 | ||
Organism | Staphylococcus aureus strain 16CS0212 |
Toxin (Protein)
Gene name | mazF | Uniprot ID | - |
Locus tag | NW971_RS10645 | Protein ID | WP_000621175.1 |
Coordinates | 2136231..2136593 (-) | Length | 121 a.a. |
Antitoxin (Protein)
Gene name | mazE | Uniprot ID | T1YCG8 |
Locus tag | NW971_RS10650 | Protein ID | WP_000948331.1 |
Coordinates | 2136590..2136760 (-) | Length | 57 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
NW971_RS10625 (NW971_10625) | 2133209..2133979 | - | 771 | WP_001041107.1 | RNA polymerase sigma factor SigB | - |
NW971_RS10630 (NW971_10630) | 2133954..2134433 | - | 480 | WP_001190825.1 | anti-sigma B factor RsbW | - |
NW971_RS10635 (NW971_10635) | 2134435..2134761 | - | 327 | WP_001052491.1 | anti-sigma factor antagonist | - |
NW971_RS10640 (NW971_10640) | 2134880..2135881 | - | 1002 | WP_000390829.1 | PP2C family protein-serine/threonine phosphatase | - |
NW971_RS10645 (NW971_10645) | 2136231..2136593 | - | 363 | WP_000621175.1 | type II toxin-antitoxin system PemK/MazF family toxin | Toxin |
NW971_RS10650 (NW971_10650) | 2136590..2136760 | - | 171 | WP_000948331.1 | type II toxin-antitoxin system antitoxin MazE | Antitoxin |
NW971_RS10655 (NW971_10655) | 2136845..2137993 | - | 1149 | WP_111762513.1 | alanine racemase | - |
NW971_RS10660 (NW971_10660) | 2138059..2138418 | - | 360 | WP_000581197.1 | holo-ACP synthase | - |
NW971_RS10665 (NW971_10665) | 2138422..2138913 | - | 492 | WP_001286981.1 | PH domain-containing protein | - |
NW971_RS10670 (NW971_10670) | 2138906..2140483 | - | 1578 | WP_258464415.1 | PH domain-containing protein | - |
NW971_RS10675 (NW971_10675) | 2140476..2140955 | - | 480 | WP_001287083.1 | hypothetical protein | - |
NW971_RS10680 (NW971_10680) | 2141164..2141724 | - | 561 | WP_258464416.1 | K(+)-transporting ATPase subunit C | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 121 a.a. Molecular weight: 13441.69 Da Isoelectric Point: 10.1654
>T254682 WP_000621175.1 NZ_CP102962:c2136593-2136231 [Staphylococcus aureus]
MIRRGDVYLADLSPVQGSEQGGVRPVVIIQNDTGNKYSPTVIVAAITGRINKAKIPTHVEIEKKKYKLDKDSVILLEQIR
TLDKKRLKEKLTYLSDDKMKEVDNALMISLGLNAVAHQKN
MIRRGDVYLADLSPVQGSEQGGVRPVVIIQNDTGNKYSPTVIVAAITGRINKAKIPTHVEIEKKKYKLDKDSVILLEQIR
TLDKKRLKEKLTYLSDDKMKEVDNALMISLGLNAVAHQKN
Download Length: 363 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|