Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) TsaAT/-
Location 810058..810535 Replicon chromosome
Accession NZ_CP102962
Organism Staphylococcus aureus strain 16CS0212

Toxin (Protein)


Gene name TsaT Uniprot ID T1Y7S2
Locus tag NW971_RS03835 Protein ID WP_000052076.1
Coordinates 810058..810246 (-) Length 63 a.a.

Antitoxin (Protein)


Gene name TsaA Uniprot ID -
Locus tag NW971_RS03840 Protein ID WP_001059749.1
Coordinates 810275..810535 (-) Length 87 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
NW971_RS03805 (NW971_03805) 806101..806571 + 471 WP_258464816.1 hypothetical protein -
NW971_RS03810 (NW971_03810) 806912..807598 + 687 WP_258464817.1 thermonuclease family protein -
NW971_RS03815 (NW971_03815) 807955..808155 + 201 WP_001059082.1 cold-shock protein -
NW971_RS03820 (NW971_03820) 808650..808868 - 219 WP_258464818.1 hypothetical protein -
NW971_RS03825 (NW971_03825) 808930..809214 - 285 WP_197804925.1 hypothetical protein -
NW971_RS03830 (NW971_03830) 809302..809871 - 570 WP_001106648.1 lipoprotein N-acylation protein LnsA -
NW971_RS03835 (NW971_03835) 810058..810246 - 189 WP_000052076.1 hypothetical protein Toxin
NW971_RS03840 (NW971_03840) 810275..810535 - 261 WP_001059749.1 hypothetical protein Antitoxin
NW971_RS03845 (NW971_03845) 810875..811078 + 204 WP_000145163.1 sterile alpha motif-like domain-containing protein -
NW971_RS03850 (NW971_03850) 811075..811311 - 237 WP_000368687.1 hypothetical protein -
NW971_RS03855 (NW971_03855) 811536..812117 + 582 WP_001140696.1 histidine phosphatase family protein -
NW971_RS03860 (NW971_03860) 812190..812807 - 618 WP_258464819.1 LysE/ArgO family amino acid transporter -
NW971_RS03865 (NW971_03865) 812964..813458 - 495 WP_000569881.1 GNAT family N-acetyltransferase -
NW971_RS03870 (NW971_03870) 813857..814279 - 423 WP_162646927.1 organic hydroperoxide resistance protein -
NW971_RS03875 (NW971_03875) 814427..815143 + 717 WP_258464820.1 type I 3-dehydroquinate dehydratase -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin


No domain identified.


Antitoxin


No domain identified.



Sequences

Toxin        


Download         Length: 63 a.a.        Molecular weight: 7142.82 Da        Isoelectric Point: 9.9971

>T254675 WP_000052076.1 NZ_CP102962:c810246-810058 [Staphylococcus aureus]
MSLHFAILFWLALIFLVAATFILVLMKKTGKESKKESYLSFTVILYIFGFAILIYTFIFGVL

Download         Length: 189 bp

Antitoxin


Download         Length: 87 a.a.        Molecular weight: 9914.01 Da        Isoelectric Point: 4.0624

>AT254675 WP_001059749.1 NZ_CP102962:c810535-810275 [Staphylococcus aureus]
MNNILSNAINIVITTTFVIFNILITYNKDLDDLCWLLPGIIICGVILIVSFTIAMITKNWLSEILFFINIVLVLYYIYPI
FYSFIG

Download         Length: 261 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A0E0VP18

Antitoxin

Source ID Structure

References