Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | mazEF/MazF(toxin) |
| Location | 2118899..2119428 | Replicon | chromosome |
| Accession | NZ_CP102961 | ||
| Organism | Staphylococcus aureus strain 03-RR-88 | ||
Toxin (Protein)
| Gene name | mazF | Uniprot ID | - |
| Locus tag | NW973_RS10465 | Protein ID | WP_000621175.1 |
| Coordinates | 2118899..2119261 (-) | Length | 121 a.a. |
Antitoxin (Protein)
| Gene name | mazE | Uniprot ID | T1YCG8 |
| Locus tag | NW973_RS10470 | Protein ID | WP_000948331.1 |
| Coordinates | 2119258..2119428 (-) | Length | 57 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| NW973_RS10445 (NW973_10445) | 2115877..2116647 | - | 771 | WP_001041107.1 | RNA polymerase sigma factor SigB | - |
| NW973_RS10450 (NW973_10450) | 2116622..2117101 | - | 480 | WP_001190829.1 | anti-sigma B factor RsbW | - |
| NW973_RS10455 (NW973_10455) | 2117103..2117429 | - | 327 | WP_001052491.1 | anti-sigma factor antagonist | - |
| NW973_RS10460 (NW973_10460) | 2117548..2118549 | - | 1002 | WP_000390829.1 | PP2C family protein-serine/threonine phosphatase | - |
| NW973_RS10465 (NW973_10465) | 2118899..2119261 | - | 363 | WP_000621175.1 | type II toxin-antitoxin system PemK/MazF family toxin | Toxin |
| NW973_RS10470 (NW973_10470) | 2119258..2119428 | - | 171 | WP_000948331.1 | type II toxin-antitoxin system antitoxin MazE | Antitoxin |
| NW973_RS10475 (NW973_10475) | 2119513..2120661 | - | 1149 | WP_258410774.1 | alanine racemase | - |
| NW973_RS10480 (NW973_10480) | 2120727..2121086 | - | 360 | WP_061838820.1 | holo-ACP synthase | - |
| NW973_RS10485 (NW973_10485) | 2121090..2121581 | - | 492 | WP_258410775.1 | PH domain-containing protein | - |
| NW973_RS10490 (NW973_10490) | 2121568..2123151 | - | 1584 | WP_258410776.1 | PH domain-containing protein | - |
| NW973_RS10495 (NW973_10495) | 2123144..2123623 | - | 480 | WP_258410777.1 | hypothetical protein | - |
| NW973_RS10500 (NW973_10500) | 2123832..2124392 | - | 561 | WP_103148787.1 | K(+)-transporting ATPase subunit C | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 121 a.a. Molecular weight: 13441.69 Da Isoelectric Point: 10.1654
>T254669 WP_000621175.1 NZ_CP102961:c2119261-2118899 [Staphylococcus aureus]
MIRRGDVYLADLSPVQGSEQGGVRPVVIIQNDTGNKYSPTVIVAAITGRINKAKIPTHVEIEKKKYKLDKDSVILLEQIR
TLDKKRLKEKLTYLSDDKMKEVDNALMISLGLNAVAHQKN
MIRRGDVYLADLSPVQGSEQGGVRPVVIIQNDTGNKYSPTVIVAAITGRINKAKIPTHVEIEKKKYKLDKDSVILLEQIR
TLDKKRLKEKLTYLSDDKMKEVDNALMISLGLNAVAHQKN
Download Length: 363 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|