Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | tsbAT/- |
Location | 1964705..1965481 | Replicon | chromosome |
Accession | NZ_CP102961 | ||
Organism | Staphylococcus aureus strain 03-RR-88 |
Toxin (Protein)
Gene name | tsbT | Uniprot ID | X5E2E6 |
Locus tag | NW973_RS09575 | Protein ID | WP_000031108.1 |
Coordinates | 1964705..1964857 (-) | Length | 51 a.a. |
Antitoxin (Protein)
Gene name | tsbA | Uniprot ID | - |
Locus tag | NW973_RS09580 | Protein ID | WP_001251230.1 |
Coordinates | 1964882..1965481 (-) | Length | 200 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
NW973_RS09560 (NW973_09560) | 1960499..1961320 | + | 822 | WP_000669376.1 | RluA family pseudouridine synthase | - |
NW973_RS09565 (NW973_09565) | 1961783..1963168 | - | 1386 | WP_000116229.1 | class II fumarate hydratase | - |
NW973_RS09570 (NW973_09570) | 1963364..1963759 | - | 396 | WP_000901023.1 | hypothetical protein | - |
NW973_RS09575 (NW973_09575) | 1964705..1964857 | - | 153 | WP_000031108.1 | SAS053 family protein | Toxin |
NW973_RS09580 (NW973_09580) | 1964882..1965481 | - | 600 | WP_001251230.1 | hypothetical protein | Antitoxin |
NW973_RS09585 (NW973_09585) | 1965640..1966110 | - | 471 | WP_000181394.1 | tRNA (uridine(34)/cytosine(34)/5- carboxymethylaminomethyluridine(34)-2'-O)- methyltransferase TrmL | - |
NW973_RS09590 (NW973_09590) | 1966115..1967242 | - | 1128 | WP_000379988.1 | tRNA epoxyqueuosine(34) reductase QueG | - |
NW973_RS09595 (NW973_09595) | 1967393..1968115 | - | 723 | WP_000590809.1 | amino acid ABC transporter ATP-binding protein | - |
NW973_RS09600 (NW973_09600) | 1968108..1969565 | - | 1458 | WP_000649908.1 | ABC transporter permease subunit | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 51 a.a. Molecular weight: 5936.28 Da Isoelectric Point: 3.8962
>T254668 WP_000031108.1 NZ_CP102961:c1964857-1964705 [Staphylococcus aureus]
MSKDKDPKLNYHEEENSMVTDFEDLKELGKEMEQISDQNDQEKNSEEDSQ
MSKDKDPKLNYHEEENSMVTDFEDLKELGKEMEQISDQNDQEKNSEEDSQ
Download Length: 153 bp
Antitoxin
Download Length: 200 a.a. Molecular weight: 22369.51 Da Isoelectric Point: 4.9728
>AT254668 WP_001251230.1 NZ_CP102961:c1965481-1964882 [Staphylococcus aureus]
MAMNFKVFDNSQLVAEYAADIIRKQFNNNPTTIAGFHLDTDQAPVLDELKKNVEKYAVDFSQINILDYDDKKSYFEALGV
PAGQVYPIAYEKDAIELIADKIKTKENKGKLTLQVVSIDEQGKLNVSIRQGLMEAREIFLVVTGANKRDVVEKLYQENGK
TSFEPADLKAHRMVNVILDKEAAAGLPEDVKAYFTSRFA
MAMNFKVFDNSQLVAEYAADIIRKQFNNNPTTIAGFHLDTDQAPVLDELKKNVEKYAVDFSQINILDYDDKKSYFEALGV
PAGQVYPIAYEKDAIELIADKIKTKENKGKLTLQVVSIDEQGKLNVSIRQGLMEAREIFLVVTGANKRDVVEKLYQENGK
TSFEPADLKAHRMVNVILDKEAAAGLPEDVKAYFTSRFA
Download Length: 600 bp
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|