Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) TsaAT/-
Location 825323..825800 Replicon chromosome
Accession NZ_CP102961
Organism Staphylococcus aureus strain 03-RR-88

Toxin (Protein)


Gene name TsaT Uniprot ID T1Y7S2
Locus tag NW973_RS03920 Protein ID WP_000052076.1
Coordinates 825323..825511 (-) Length 63 a.a.

Antitoxin (Protein)


Gene name TsaA Uniprot ID T1Y6P8
Locus tag NW973_RS03925 Protein ID WP_001059690.1
Coordinates 825540..825800 (-) Length 87 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
NW973_RS03890 (NW973_03890) 821365..821835 + 471 WP_000824472.1 hypothetical protein -
NW973_RS03895 (NW973_03895) 822176..822862 + 687 WP_072496504.1 thermonuclease family protein -
NW973_RS03900 (NW973_03900) 823219..823419 + 201 WP_001059082.1 cold-shock protein -
NW973_RS03905 (NW973_03905) 823914..824132 - 219 WP_006189856.1 hypothetical protein -
NW973_RS03910 (NW973_03910) 824194..824478 - 285 WP_001004395.1 hypothetical protein -
NW973_RS03915 (NW973_03915) 824566..825135 - 570 WP_001106654.1 lipoprotein N-acylation protein LnsA -
NW973_RS03920 (NW973_03920) 825323..825511 - 189 WP_000052076.1 hypothetical protein Toxin
NW973_RS03925 (NW973_03925) 825540..825800 - 261 WP_001059690.1 hypothetical protein Antitoxin
NW973_RS03930 (NW973_03930) 826141..826344 + 204 WP_000145163.1 sterile alpha motif-like domain-containing protein -
NW973_RS03935 (NW973_03935) 826341..826577 - 237 WP_000368687.1 hypothetical protein -
NW973_RS03940 (NW973_03940) 826802..827383 + 582 WP_001140693.1 histidine phosphatase family protein -
NW973_RS03945 (NW973_03945) 827456..828073 - 618 WP_000255561.1 LysE/ArgO family amino acid transporter -
NW973_RS03950 (NW973_03950) 828228..828722 - 495 WP_000569884.1 GNAT family N-acetyltransferase -
NW973_RS03955 (NW973_03955) 829121..829543 - 423 WP_000974460.1 organic hydroperoxide resistance protein -
NW973_RS03960 (NW973_03960) 829691..830407 + 717 WP_258411042.1 type I 3-dehydroquinate dehydratase -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin


No domain identified.


Antitoxin


No domain identified.



Sequences

Toxin        


Download         Length: 63 a.a.        Molecular weight: 7142.82 Da        Isoelectric Point: 9.9971

>T254666 WP_000052076.1 NZ_CP102961:c825511-825323 [Staphylococcus aureus]
MSLHFAILFWLALIFLVAATFILVLMKKTGKESKKESYLSFTVILYIFGFAILIYTFIFGVL

Download         Length: 189 bp

Antitoxin


Download         Length: 87 a.a.        Molecular weight: 9940.09 Da        Isoelectric Point: 4.0624

>AT254666 WP_001059690.1 NZ_CP102961:c825800-825540 [Staphylococcus aureus]
MNNILLNAINIVITTTFVIFNILITYNKDLDDLCWLLPGIIICGVILIVSFTIAMITKNWLSEILFFINIVLVLYYIYPI
FYSFIG

Download         Length: 261 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A0E0VP18

Antitoxin

Source ID Structure
AlphaFold DB A0A0E0VN56

References