Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | mazEF/MazF(toxin) |
| Location | 2045792..2046321 | Replicon | chromosome |
| Accession | NZ_CP102960 | ||
| Organism | Staphylococcus aureus strain 07-G-D | ||
Toxin (Protein)
| Gene name | mazF | Uniprot ID | - |
| Locus tag | NW949_RS09925 | Protein ID | WP_000621175.1 |
| Coordinates | 2045792..2046154 (-) | Length | 121 a.a. |
Antitoxin (Protein)
| Gene name | mazE | Uniprot ID | T1YCG8 |
| Locus tag | NW949_RS09930 | Protein ID | WP_000948331.1 |
| Coordinates | 2046151..2046321 (-) | Length | 57 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| NW949_RS09905 (NW949_09905) | 2042770..2043540 | - | 771 | WP_001041102.1 | RNA polymerase sigma factor SigB | - |
| NW949_RS09910 (NW949_09910) | 2043515..2043994 | - | 480 | WP_001190829.1 | anti-sigma B factor RsbW | - |
| NW949_RS09915 (NW949_09915) | 2043996..2044322 | - | 327 | WP_001052491.1 | anti-sigma factor antagonist | - |
| NW949_RS09920 (NW949_09920) | 2044441..2045442 | - | 1002 | WP_000390829.1 | PP2C family protein-serine/threonine phosphatase | - |
| NW949_RS09925 (NW949_09925) | 2045792..2046154 | - | 363 | WP_000621175.1 | type II toxin-antitoxin system PemK/MazF family toxin | Toxin |
| NW949_RS09930 (NW949_09930) | 2046151..2046321 | - | 171 | WP_000948331.1 | type II toxin-antitoxin system antitoxin MazE | Antitoxin |
| NW949_RS09935 (NW949_09935) | 2046406..2047554 | - | 1149 | WP_258415319.1 | alanine racemase | - |
| NW949_RS09940 (NW949_09940) | 2047620..2047979 | - | 360 | WP_000581200.1 | holo-ACP synthase | - |
| NW949_RS09945 (NW949_09945) | 2047983..2048474 | - | 492 | WP_001205910.1 | PH domain-containing protein | - |
| NW949_RS09950 (NW949_09950) | 2048461..2050044 | - | 1584 | WP_258415320.1 | PH domain-containing protein | - |
| NW949_RS09955 (NW949_09955) | 2050037..2050516 | - | 480 | WP_001287079.1 | hypothetical protein | - |
| NW949_RS09960 (NW949_09960) | 2050725..2051285 | - | 561 | WP_001092409.1 | K(+)-transporting ATPase subunit C | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 121 a.a. Molecular weight: 13441.69 Da Isoelectric Point: 10.1654
>T254659 WP_000621175.1 NZ_CP102960:c2046154-2045792 [Staphylococcus aureus]
MIRRGDVYLADLSPVQGSEQGGVRPVVIIQNDTGNKYSPTVIVAAITGRINKAKIPTHVEIEKKKYKLDKDSVILLEQIR
TLDKKRLKEKLTYLSDDKMKEVDNALMISLGLNAVAHQKN
MIRRGDVYLADLSPVQGSEQGGVRPVVIIQNDTGNKYSPTVIVAAITGRINKAKIPTHVEIEKKKYKLDKDSVILLEQIR
TLDKKRLKEKLTYLSDDKMKEVDNALMISLGLNAVAHQKN
Download Length: 363 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|