Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | tsbAT/- |
| Location | 1885232..1886008 | Replicon | chromosome |
| Accession | NZ_CP102960 | ||
| Organism | Staphylococcus aureus strain 07-G-D | ||
Toxin (Protein)
| Gene name | tsbT | Uniprot ID | X5E2E6 |
| Locus tag | NW949_RS08995 | Protein ID | WP_000031108.1 |
| Coordinates | 1885232..1885384 (-) | Length | 51 a.a. |
Antitoxin (Protein)
| Gene name | tsbA | Uniprot ID | W8U4V4 |
| Locus tag | NW949_RS09000 | Protein ID | WP_001251224.1 |
| Coordinates | 1885409..1886008 (-) | Length | 200 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| NW949_RS08975 (NW949_08975) | 1881180..1881251 | - | 72 | Protein_1756 | hypothetical protein | - |
| NW949_RS08980 (NW949_08980) | 1881254..1882573 | - | 1320 | WP_258415554.1 | ISL3-like element IS1181 family transposase | - |
| NW949_RS08985 (NW949_08985) | 1882712..1884097 | - | 1386 | WP_000116229.1 | class II fumarate hydratase | - |
| NW949_RS08990 (NW949_08990) | 1884293..1884688 | - | 396 | WP_000901023.1 | hypothetical protein | - |
| NW949_RS08995 (NW949_08995) | 1885232..1885384 | - | 153 | WP_000031108.1 | SAS053 family protein | Toxin |
| NW949_RS09000 (NW949_09000) | 1885409..1886008 | - | 600 | WP_001251224.1 | glucosamine-6-phosphate isomerase | Antitoxin |
| NW949_RS09005 (NW949_09005) | 1886167..1886637 | - | 471 | WP_000181394.1 | tRNA (uridine(34)/cytosine(34)/5- carboxymethylaminomethyluridine(34)-2'-O)- methyltransferase TrmL | - |
| NW949_RS09010 (NW949_09010) | 1886642..1887769 | - | 1128 | WP_000379980.1 | tRNA epoxyqueuosine(34) reductase QueG | - |
| NW949_RS09015 (NW949_09015) | 1887920..1888642 | - | 723 | WP_000590809.1 | amino acid ABC transporter ATP-binding protein | - |
| NW949_RS09020 (NW949_09020) | 1888635..1890092 | - | 1458 | WP_000649907.1 | ABC transporter permease subunit | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Prophage | - | lukD / hlgA | 1832939..1888648 | 55709 | |
| - | flank | IS/Tn | - | - | 1881254..1882573 | 1319 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 51 a.a. Molecular weight: 5936.28 Da Isoelectric Point: 3.8962
>T254658 WP_000031108.1 NZ_CP102960:c1885384-1885232 [Staphylococcus aureus]
MSKDKDPKLNYHEEENSMVTDFEDLKELGKEMEQISDQNDQEKNSEEDSQ
MSKDKDPKLNYHEEENSMVTDFEDLKELGKEMEQISDQNDQEKNSEEDSQ
Download Length: 153 bp
Antitoxin
Download Length: 200 a.a. Molecular weight: 22343.47 Da Isoelectric Point: 5.1445
>AT254658 WP_001251224.1 NZ_CP102960:c1886008-1885409 [Staphylococcus aureus]
MAMNFKVFDNSQLVAEYAADIIRKQFNNNPTTIAGFHLDTDQAPVLDELKKNVEKHAVDFSQINILDYDDKKSYFEALGV
PAGQVYPIAYEKDAIELIADKIKTKENKGKLTLQVVSIDEQGKLNVSIRQGLMEAREIFLVVTGANKRDVVEKLYQENGK
TSFEPADLKAHRMVNVILDKEAAAGLPEDVKAYFTSRFA
MAMNFKVFDNSQLVAEYAADIIRKQFNNNPTTIAGFHLDTDQAPVLDELKKNVEKHAVDFSQINILDYDDKKSYFEALGV
PAGQVYPIAYEKDAIELIADKIKTKENKGKLTLQVVSIDEQGKLNVSIRQGLMEAREIFLVVTGANKRDVVEKLYQENGK
TSFEPADLKAHRMVNVILDKEAAAGLPEDVKAYFTSRFA
Download Length: 600 bp
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|