Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) TsaAT/-
Location 834467..834944 Replicon chromosome
Accession NZ_CP102960
Organism Staphylococcus aureus strain 07-G-D

Toxin (Protein)


Gene name TsaT Uniprot ID T1Y7S2
Locus tag NW949_RS03975 Protein ID WP_000052076.1
Coordinates 834467..834655 (-) Length 63 a.a.

Antitoxin (Protein)


Gene name TsaA Uniprot ID T1Y6P8
Locus tag NW949_RS03980 Protein ID WP_001059690.1
Coordinates 834684..834944 (-) Length 87 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
NW949_RS03945 (NW949_03945) 830458..830979 + 522 WP_000824487.1 hypothetical protein -
NW949_RS03950 (NW949_03950) 831320..832006 + 687 WP_258415505.1 thermonuclease family protein -
NW949_RS03955 (NW949_03955) 832363..832563 + 201 WP_001059082.1 cold-shock protein -
NW949_RS03960 (NW949_03960) 833058..833276 - 219 WP_258415506.1 hypothetical protein -
NW949_RS03965 (NW949_03965) 833338..833622 - 285 WP_258415507.1 hypothetical protein -
NW949_RS03970 (NW949_03970) 833710..834279 - 570 WP_258415508.1 lipoprotein N-acylation protein LnsA -
NW949_RS03975 (NW949_03975) 834467..834655 - 189 WP_000052076.1 hypothetical protein Toxin
NW949_RS03980 (NW949_03980) 834684..834944 - 261 WP_001059690.1 hypothetical protein Antitoxin
NW949_RS03985 (NW949_03985) 835284..835487 + 204 WP_000145163.1 sterile alpha motif-like domain-containing protein -
NW949_RS03990 (NW949_03990) 835484..835720 - 237 WP_000368687.1 hypothetical protein -
NW949_RS03995 (NW949_03995) 835945..836526 + 582 WP_001140697.1 histidine phosphatase family protein -
NW949_RS04000 (NW949_04000) 836599..837216 - 618 WP_000255553.1 LysE/ArgO family amino acid transporter -
NW949_RS04005 (NW949_04005) 837371..837865 - 495 WP_000569884.1 GNAT family N-acetyltransferase -
NW949_RS04010 (NW949_04010) 838264..838686 - 423 WP_000974460.1 organic hydroperoxide resistance protein -
NW949_RS04015 (NW949_04015) 838834..839550 + 717 WP_000150019.1 type I 3-dehydroquinate dehydratase -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin


No domain identified.


Antitoxin


No domain identified.



Sequences

Toxin        


Download         Length: 63 a.a.        Molecular weight: 7142.82 Da        Isoelectric Point: 9.9971

>T254657 WP_000052076.1 NZ_CP102960:c834655-834467 [Staphylococcus aureus]
MSLHFAILFWLALIFLVAATFILVLMKKTGKESKKESYLSFTVILYIFGFAILIYTFIFGVL

Download         Length: 189 bp

Antitoxin


Download         Length: 87 a.a.        Molecular weight: 9940.09 Da        Isoelectric Point: 4.0624

>AT254657 WP_001059690.1 NZ_CP102960:c834944-834684 [Staphylococcus aureus]
MNNILLNAINIVITTTFVIFNILITYNKDLDDLCWLLPGIIICGVILIVSFTIAMITKNWLSEILFFINIVLVLYYIYPI
FYSFIG

Download         Length: 261 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A0E0VP18

Antitoxin

Source ID Structure
AlphaFold DB A0A0E0VN56

References