Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | mazEF/MazF(toxin) |
| Location | 2058625..2059154 | Replicon | chromosome |
| Accession | NZ_CP102959 | ||
| Organism | Staphylococcus aureus strain 12-G-51 | ||
Toxin (Protein)
| Gene name | mazF | Uniprot ID | - |
| Locus tag | NW979_RS09925 | Protein ID | WP_000621175.1 |
| Coordinates | 2058625..2058987 (-) | Length | 121 a.a. |
Antitoxin (Protein)
| Gene name | mazE | Uniprot ID | T1YCG8 |
| Locus tag | NW979_RS09930 | Protein ID | WP_000948331.1 |
| Coordinates | 2058984..2059154 (-) | Length | 57 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| NW979_RS09905 (NW979_09905) | 2055603..2056373 | - | 771 | WP_001041107.1 | RNA polymerase sigma factor SigB | - |
| NW979_RS09910 (NW979_09910) | 2056348..2056827 | - | 480 | WP_001190829.1 | anti-sigma B factor RsbW | - |
| NW979_RS09915 (NW979_09915) | 2056829..2057155 | - | 327 | WP_001052491.1 | anti-sigma factor antagonist | - |
| NW979_RS09920 (NW979_09920) | 2057274..2058275 | - | 1002 | WP_000390829.1 | PP2C family protein-serine/threonine phosphatase | - |
| NW979_RS09925 (NW979_09925) | 2058625..2058987 | - | 363 | WP_000621175.1 | type II toxin-antitoxin system PemK/MazF family toxin | Toxin |
| NW979_RS09930 (NW979_09930) | 2058984..2059154 | - | 171 | WP_000948331.1 | type II toxin-antitoxin system antitoxin MazE | Antitoxin |
| NW979_RS09935 (NW979_09935) | 2059239..2060387 | - | 1149 | WP_001281145.1 | alanine racemase | - |
| NW979_RS09940 (NW979_09940) | 2060453..2060812 | - | 360 | WP_000581202.1 | holo-ACP synthase | - |
| NW979_RS09945 (NW979_09945) | 2060816..2061307 | - | 492 | WP_001205912.1 | PH domain-containing protein | - |
| NW979_RS09950 (NW979_09950) | 2061294..2062877 | - | 1584 | WP_001294626.1 | PH domain-containing protein | - |
| NW979_RS09955 (NW979_09955) | 2062870..2063349 | - | 480 | WP_001287078.1 | hypothetical protein | - |
| NW979_RS09960 (NW979_09960) | 2063558..2064016 | - | 459 | Protein_1917 | potassium-transporting ATPase subunit C | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | flank | IS/Tn | - | - | 2064139..2064624 | 485 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 121 a.a. Molecular weight: 13441.69 Da Isoelectric Point: 10.1654
>T254652 WP_000621175.1 NZ_CP102959:c2058987-2058625 [Staphylococcus aureus]
MIRRGDVYLADLSPVQGSEQGGVRPVVIIQNDTGNKYSPTVIVAAITGRINKAKIPTHVEIEKKKYKLDKDSVILLEQIR
TLDKKRLKEKLTYLSDDKMKEVDNALMISLGLNAVAHQKN
MIRRGDVYLADLSPVQGSEQGGVRPVVIIQNDTGNKYSPTVIVAAITGRINKAKIPTHVEIEKKKYKLDKDSVILLEQIR
TLDKKRLKEKLTYLSDDKMKEVDNALMISLGLNAVAHQKN
Download Length: 363 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|