Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) mazEF/MazF(toxin)
Location 2058625..2059154 Replicon chromosome
Accession NZ_CP102959
Organism Staphylococcus aureus strain 12-G-51

Toxin (Protein)


Gene name mazF Uniprot ID -
Locus tag NW979_RS09925 Protein ID WP_000621175.1
Coordinates 2058625..2058987 (-) Length 121 a.a.

Antitoxin (Protein)


Gene name mazE Uniprot ID T1YCG8
Locus tag NW979_RS09930 Protein ID WP_000948331.1
Coordinates 2058984..2059154 (-) Length 57 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
NW979_RS09905 (NW979_09905) 2055603..2056373 - 771 WP_001041107.1 RNA polymerase sigma factor SigB -
NW979_RS09910 (NW979_09910) 2056348..2056827 - 480 WP_001190829.1 anti-sigma B factor RsbW -
NW979_RS09915 (NW979_09915) 2056829..2057155 - 327 WP_001052491.1 anti-sigma factor antagonist -
NW979_RS09920 (NW979_09920) 2057274..2058275 - 1002 WP_000390829.1 PP2C family protein-serine/threonine phosphatase -
NW979_RS09925 (NW979_09925) 2058625..2058987 - 363 WP_000621175.1 type II toxin-antitoxin system PemK/MazF family toxin Toxin
NW979_RS09930 (NW979_09930) 2058984..2059154 - 171 WP_000948331.1 type II toxin-antitoxin system antitoxin MazE Antitoxin
NW979_RS09935 (NW979_09935) 2059239..2060387 - 1149 WP_001281145.1 alanine racemase -
NW979_RS09940 (NW979_09940) 2060453..2060812 - 360 WP_000581202.1 holo-ACP synthase -
NW979_RS09945 (NW979_09945) 2060816..2061307 - 492 WP_001205912.1 PH domain-containing protein -
NW979_RS09950 (NW979_09950) 2061294..2062877 - 1584 WP_001294626.1 PH domain-containing protein -
NW979_RS09955 (NW979_09955) 2062870..2063349 - 480 WP_001287078.1 hypothetical protein -
NW979_RS09960 (NW979_09960) 2063558..2064016 - 459 Protein_1917 potassium-transporting ATPase subunit C -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- flank IS/Tn - - 2064139..2064624 485


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

mRNA interferase PemK-like

(3-110)

Antitoxin


No domain identified.



Sequences

Toxin        


Download         Length: 121 a.a.        Molecular weight: 13441.69 Da        Isoelectric Point: 10.1654

>T254652 WP_000621175.1 NZ_CP102959:c2058987-2058625 [Staphylococcus aureus]
MIRRGDVYLADLSPVQGSEQGGVRPVVIIQNDTGNKYSPTVIVAAITGRINKAKIPTHVEIEKKKYKLDKDSVILLEQIR
TLDKKRLKEKLTYLSDDKMKEVDNALMISLGLNAVAHQKN

Download         Length: 363 bp

Antitoxin


Download         Length: 57 a.a.        Molecular weight: 6251.78 Da        Isoelectric Point: 3.8305

>AT254652 WP_000948331.1 NZ_CP102959:c2059154-2058984 [Staphylococcus aureus]
MLSFSQNRSHSLEQSLKEGYSQMADLNLSLANEAFPIECEACDCNETYLSSNSTNE

Download         Length: 171 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure

Antitoxin

Source ID Structure
AlphaFold DB A0A0E0VRZ1

References