Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) TsaAT/-
Location 840167..840644 Replicon chromosome
Accession NZ_CP102959
Organism Staphylococcus aureus strain 12-G-51

Toxin (Protein)


Gene name TsaT Uniprot ID T1Y7S2
Locus tag NW979_RS03935 Protein ID WP_000052076.1
Coordinates 840167..840355 (-) Length 63 a.a.

Antitoxin (Protein)


Gene name TsaA Uniprot ID T1Y6P8
Locus tag NW979_RS03940 Protein ID WP_001059690.1
Coordinates 840384..840644 (-) Length 87 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
NW979_RS03905 (NW979_03905) 836156..836677 + 522 WP_258413771.1 hypothetical protein -
NW979_RS03910 (NW979_03910) 837018..837704 + 687 WP_001670297.1 thermonuclease family protein -
NW979_RS03915 (NW979_03915) 838061..838261 + 201 WP_001059082.1 cold-shock protein -
NW979_RS03920 (NW979_03920) 838758..838976 - 219 WP_258413772.1 hypothetical protein -
NW979_RS03925 (NW979_03925) 839038..839322 - 285 WP_258413773.1 hypothetical protein -
NW979_RS03930 (NW979_03930) 839410..839979 - 570 WP_001106646.1 lipoprotein N-acylation protein LnsA -
NW979_RS03935 (NW979_03935) 840167..840355 - 189 WP_000052076.1 hypothetical protein Toxin
NW979_RS03940 (NW979_03940) 840384..840644 - 261 WP_001059690.1 hypothetical protein Antitoxin
NW979_RS03945 (NW979_03945) 840984..841187 + 204 WP_000145163.1 sterile alpha motif-like domain-containing protein -
NW979_RS03950 (NW979_03950) 841184..841420 - 237 WP_000368687.1 hypothetical protein -
NW979_RS03955 (NW979_03955) 841645..842226 + 582 WP_001140696.1 histidine phosphatase family protein -
NW979_RS03960 (NW979_03960) 842299..842916 - 618 WP_258413774.1 LysE/ArgO family amino acid transporter -
NW979_RS03965 (NW979_03965) 843072..843566 - 495 WP_000569884.1 GNAT family N-acetyltransferase -
NW979_RS03970 (NW979_03970) 843965..844387 - 423 WP_000974455.1 organic hydroperoxide resistance protein -
NW979_RS03975 (NW979_03975) 844535..845251 + 717 WP_258413775.1 type I 3-dehydroquinate dehydratase -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin


No domain identified.


Antitoxin


No domain identified.



Sequences

Toxin        


Download         Length: 63 a.a.        Molecular weight: 7142.82 Da        Isoelectric Point: 9.9971

>T254650 WP_000052076.1 NZ_CP102959:c840355-840167 [Staphylococcus aureus]
MSLHFAILFWLALIFLVAATFILVLMKKTGKESKKESYLSFTVILYIFGFAILIYTFIFGVL

Download         Length: 189 bp

Antitoxin


Download         Length: 87 a.a.        Molecular weight: 9940.09 Da        Isoelectric Point: 4.0624

>AT254650 WP_001059690.1 NZ_CP102959:c840644-840384 [Staphylococcus aureus]
MNNILLNAINIVITTTFVIFNILITYNKDLDDLCWLLPGIIICGVILIVSFTIAMITKNWLSEILFFINIVLVLYYIYPI
FYSFIG

Download         Length: 261 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A0E0VP18

Antitoxin

Source ID Structure
AlphaFold DB A0A0E0VN56

References