Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | mazEF/MazF(toxin) |
Location | 2011405..2011934 | Replicon | chromosome |
Accession | NZ_CP102958 | ||
Organism | Staphylococcus aureus strain 15-G-54 |
Toxin (Protein)
Gene name | mazF | Uniprot ID | - |
Locus tag | NW969_RS09695 | Protein ID | WP_000621175.1 |
Coordinates | 2011405..2011767 (-) | Length | 121 a.a. |
Antitoxin (Protein)
Gene name | mazE | Uniprot ID | T1YCG8 |
Locus tag | NW969_RS09700 | Protein ID | WP_000948331.1 |
Coordinates | 2011764..2011934 (-) | Length | 57 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
NW969_RS09675 (NW969_09675) | 2008383..2009153 | - | 771 | WP_001041107.1 | RNA polymerase sigma factor SigB | - |
NW969_RS09680 (NW969_09680) | 2009128..2009607 | - | 480 | WP_258413936.1 | anti-sigma B factor RsbW | - |
NW969_RS09685 (NW969_09685) | 2009609..2009935 | - | 327 | WP_001052491.1 | anti-sigma factor antagonist | - |
NW969_RS09690 (NW969_09690) | 2010054..2011055 | - | 1002 | WP_000390829.1 | PP2C family protein-serine/threonine phosphatase | - |
NW969_RS09695 (NW969_09695) | 2011405..2011767 | - | 363 | WP_000621175.1 | type II toxin-antitoxin system PemK/MazF family toxin | Toxin |
NW969_RS09700 (NW969_09700) | 2011764..2011934 | - | 171 | WP_000948331.1 | type II toxin-antitoxin system antitoxin MazE | Antitoxin |
NW969_RS09705 (NW969_09705) | 2012019..2013167 | - | 1149 | WP_001281154.1 | alanine racemase | - |
NW969_RS09710 (NW969_09710) | 2013233..2013592 | - | 360 | WP_000581197.1 | holo-ACP synthase | - |
NW969_RS09715 (NW969_09715) | 2013596..2014087 | - | 492 | WP_001205912.1 | PH domain-containing protein | - |
NW969_RS09720 (NW969_09720) | 2014074..2015657 | - | 1584 | WP_258413937.1 | PH domain-containing protein | - |
NW969_RS09725 (NW969_09725) | 2015650..2016129 | - | 480 | WP_001287078.1 | hypothetical protein | - |
NW969_RS09730 (NW969_09730) | 2016338..2016898 | - | 561 | WP_061838823.1 | K(+)-transporting ATPase subunit C | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 121 a.a. Molecular weight: 13441.69 Da Isoelectric Point: 10.1654
>T254644 WP_000621175.1 NZ_CP102958:c2011767-2011405 [Staphylococcus aureus]
MIRRGDVYLADLSPVQGSEQGGVRPVVIIQNDTGNKYSPTVIVAAITGRINKAKIPTHVEIEKKKYKLDKDSVILLEQIR
TLDKKRLKEKLTYLSDDKMKEVDNALMISLGLNAVAHQKN
MIRRGDVYLADLSPVQGSEQGGVRPVVIIQNDTGNKYSPTVIVAAITGRINKAKIPTHVEIEKKKYKLDKDSVILLEQIR
TLDKKRLKEKLTYLSDDKMKEVDNALMISLGLNAVAHQKN
Download Length: 363 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|