Detailed information of TA system
Overview
TA module
Type | II | Classification (family/domain) | tsbAT/- |
Location | 1850811..1851587 | Replicon | chromosome |
Accession | NZ_CP102958 | ||
Organism | Staphylococcus aureus strain 15-G-54 |
Toxin (Protein)
Gene name | tsbT | Uniprot ID | X5E2E6 |
Locus tag | NW969_RS08760 | Protein ID | WP_000031108.1 |
Coordinates | 1850811..1850963 (-) | Length | 51 a.a. |
Antitoxin (Protein)
Gene name | tsbA | Uniprot ID | W8U4V4 |
Locus tag | NW969_RS08765 | Protein ID | WP_001251224.1 |
Coordinates | 1850988..1851587 (-) | Length | 200 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
NW969_RS08745 (NW969_08745) | 1846840..1847661 | + | 822 | WP_000669376.1 | RluA family pseudouridine synthase | - |
NW969_RS08750 (NW969_08750) | 1848124..1849509 | - | 1386 | WP_258413920.1 | class II fumarate hydratase | - |
NW969_RS08755 (NW969_08755) | 1849705..1850100 | - | 396 | WP_000901023.1 | hypothetical protein | - |
NW969_RS08760 (NW969_08760) | 1850811..1850963 | - | 153 | WP_000031108.1 | SAS053 family protein | Toxin |
NW969_RS08765 (NW969_08765) | 1850988..1851587 | - | 600 | WP_001251224.1 | glucosamine-6-phosphate isomerase | Antitoxin |
NW969_RS08770 (NW969_08770) | 1851746..1852216 | - | 471 | WP_000181394.1 | tRNA (uridine(34)/cytosine(34)/5- carboxymethylaminomethyluridine(34)-2'-O)- methyltransferase TrmL | - |
NW969_RS08775 (NW969_08775) | 1852221..1853348 | - | 1128 | WP_000379981.1 | tRNA epoxyqueuosine(34) reductase QueG | - |
NW969_RS08780 (NW969_08780) | 1853499..1854221 | - | 723 | WP_000590809.1 | amino acid ABC transporter ATP-binding protein | - |
NW969_RS08785 (NW969_08785) | 1854214..1855671 | - | 1458 | WP_000649908.1 | ABC transporter permease subunit | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 51 a.a. Molecular weight: 5936.28 Da Isoelectric Point: 3.8962
>T254643 WP_000031108.1 NZ_CP102958:c1850963-1850811 [Staphylococcus aureus]
MSKDKDPKLNYHEEENSMVTDFEDLKELGKEMEQISDQNDQEKNSEEDSQ
MSKDKDPKLNYHEEENSMVTDFEDLKELGKEMEQISDQNDQEKNSEEDSQ
Download Length: 153 bp
Antitoxin
Download Length: 200 a.a. Molecular weight: 22343.47 Da Isoelectric Point: 5.1445
>AT254643 WP_001251224.1 NZ_CP102958:c1851587-1850988 [Staphylococcus aureus]
MAMNFKVFDNSQLVAEYAADIIRKQFNNNPTTIAGFHLDTDQAPVLDELKKNVEKHAVDFSQINILDYDDKKSYFEALGV
PAGQVYPIAYEKDAIELIADKIKTKENKGKLTLQVVSIDEQGKLNVSIRQGLMEAREIFLVVTGANKRDVVEKLYQENGK
TSFEPADLKAHRMVNVILDKEAAAGLPEDVKAYFTSRFA
MAMNFKVFDNSQLVAEYAADIIRKQFNNNPTTIAGFHLDTDQAPVLDELKKNVEKHAVDFSQINILDYDDKKSYFEALGV
PAGQVYPIAYEKDAIELIADKIKTKENKGKLTLQVVSIDEQGKLNVSIRQGLMEAREIFLVVTGANKRDVVEKLYQENGK
TSFEPADLKAHRMVNVILDKEAAAGLPEDVKAYFTSRFA
Download Length: 600 bp
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|