Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) TsaAT/-
Location 806251..806728 Replicon chromosome
Accession NZ_CP102958
Organism Staphylococcus aureus strain 15-G-54

Toxin (Protein)


Gene name TsaT Uniprot ID T1Y7S2
Locus tag NW969_RS03755 Protein ID WP_000052076.1
Coordinates 806251..806439 (-) Length 63 a.a.

Antitoxin (Protein)


Gene name TsaA Uniprot ID T1Y6P8
Locus tag NW969_RS03760 Protein ID WP_001059690.1
Coordinates 806468..806728 (-) Length 87 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
NW969_RS03725 (NW969_03725) 802292..802762 + 471 WP_000824467.1 hypothetical protein -
NW969_RS03730 (NW969_03730) 803103..803789 + 687 WP_072361002.1 thermonuclease family protein -
NW969_RS03735 (NW969_03735) 804146..804346 + 201 WP_001059082.1 cold-shock protein -
NW969_RS03740 (NW969_03740) 804842..805060 - 219 WP_000005886.1 hypothetical protein -
NW969_RS03745 (NW969_03745) 805122..805406 - 285 WP_001004401.1 hypothetical protein -
NW969_RS03750 (NW969_03750) 805494..806063 - 570 WP_001106654.1 lipoprotein N-acylation protein LnsA -
NW969_RS03755 (NW969_03755) 806251..806439 - 189 WP_000052076.1 hypothetical protein Toxin
NW969_RS03760 (NW969_03760) 806468..806728 - 261 WP_001059690.1 hypothetical protein Antitoxin
NW969_RS03765 (NW969_03765) 807068..807271 + 204 WP_000145163.1 sterile alpha motif-like domain-containing protein -
NW969_RS03770 (NW969_03770) 807268..807504 - 237 WP_000368687.1 hypothetical protein -
NW969_RS03775 (NW969_03775) 807729..808310 + 582 WP_001140693.1 histidine phosphatase family protein -
NW969_RS03780 (NW969_03780) 808383..809000 - 618 WP_000255553.1 LysE/ArgO family amino acid transporter -
NW969_RS03785 (NW969_03785) 809156..809650 - 495 WP_000569884.1 GNAT family N-acetyltransferase -
NW969_RS03790 (NW969_03790) 810049..810471 - 423 WP_258414090.1 organic hydroperoxide resistance protein -
NW969_RS03795 (NW969_03795) 810619..811335 + 717 WP_258414091.1 type I 3-dehydroquinate dehydratase -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin


No domain identified.


Antitoxin


No domain identified.



Sequences

Toxin        


Download         Length: 63 a.a.        Molecular weight: 7142.82 Da        Isoelectric Point: 9.9971

>T254641 WP_000052076.1 NZ_CP102958:c806439-806251 [Staphylococcus aureus]
MSLHFAILFWLALIFLVAATFILVLMKKTGKESKKESYLSFTVILYIFGFAILIYTFIFGVL

Download         Length: 189 bp

Antitoxin


Download         Length: 87 a.a.        Molecular weight: 9940.09 Da        Isoelectric Point: 4.0624

>AT254641 WP_001059690.1 NZ_CP102958:c806728-806468 [Staphylococcus aureus]
MNNILLNAINIVITTTFVIFNILITYNKDLDDLCWLLPGIIICGVILIVSFTIAMITKNWLSEILFFINIVLVLYYIYPI
FYSFIG

Download         Length: 261 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A0E0VP18

Antitoxin

Source ID Structure
AlphaFold DB A0A0E0VN56

References