Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | mazEF/MazF(toxin) |
Location | 2017219..2017748 | Replicon | chromosome |
Accession | NZ_CP102957 | ||
Organism | Staphylococcus aureus strain 18-H-62 |
Toxin (Protein)
Gene name | mazF | Uniprot ID | - |
Locus tag | NW959_RS09800 | Protein ID | WP_000621175.1 |
Coordinates | 2017219..2017581 (-) | Length | 121 a.a. |
Antitoxin (Protein)
Gene name | mazE | Uniprot ID | T1YCG8 |
Locus tag | NW959_RS09805 | Protein ID | WP_000948331.1 |
Coordinates | 2017578..2017748 (-) | Length | 57 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
NW959_RS09780 (NW959_09780) | 2014197..2014967 | - | 771 | WP_001041107.1 | RNA polymerase sigma factor SigB | - |
NW959_RS09785 (NW959_09785) | 2014942..2015421 | - | 480 | WP_001190829.1 | anti-sigma B factor RsbW | - |
NW959_RS09790 (NW959_09790) | 2015423..2015749 | - | 327 | WP_001052491.1 | anti-sigma factor antagonist | - |
NW959_RS09795 (NW959_09795) | 2015868..2016869 | - | 1002 | WP_000390829.1 | PP2C family protein-serine/threonine phosphatase | - |
NW959_RS09800 (NW959_09800) | 2017219..2017581 | - | 363 | WP_000621175.1 | type II toxin-antitoxin system PemK/MazF family toxin | Toxin |
NW959_RS09805 (NW959_09805) | 2017578..2017748 | - | 171 | WP_000948331.1 | type II toxin-antitoxin system antitoxin MazE | Antitoxin |
NW959_RS09810 (NW959_09810) | 2017833..2018981 | - | 1149 | WP_072496962.1 | alanine racemase | - |
NW959_RS09815 (NW959_09815) | 2019047..2019406 | - | 360 | WP_061838820.1 | holo-ACP synthase | - |
NW959_RS09820 (NW959_09820) | 2019410..2019901 | - | 492 | WP_072496961.1 | PH domain-containing protein | - |
NW959_RS09825 (NW959_09825) | 2019888..2021471 | - | 1584 | WP_258414916.1 | PH domain-containing protein | - |
NW959_RS09830 (NW959_09830) | 2021464..2021943 | - | 480 | WP_001287079.1 | hypothetical protein | - |
NW959_RS09835 (NW959_09835) | 2022152..2022712 | - | 561 | WP_072496959.1 | K(+)-transporting ATPase subunit C | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 121 a.a. Molecular weight: 13441.69 Da Isoelectric Point: 10.1654
>T254635 WP_000621175.1 NZ_CP102957:c2017581-2017219 [Staphylococcus aureus]
MIRRGDVYLADLSPVQGSEQGGVRPVVIIQNDTGNKYSPTVIVAAITGRINKAKIPTHVEIEKKKYKLDKDSVILLEQIR
TLDKKRLKEKLTYLSDDKMKEVDNALMISLGLNAVAHQKN
MIRRGDVYLADLSPVQGSEQGGVRPVVIIQNDTGNKYSPTVIVAAITGRINKAKIPTHVEIEKKKYKLDKDSVILLEQIR
TLDKKRLKEKLTYLSDDKMKEVDNALMISLGLNAVAHQKN
Download Length: 363 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|