Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | tsbAT/- |
Location | 1862479..1863255 | Replicon | chromosome |
Accession | NZ_CP102957 | ||
Organism | Staphylococcus aureus strain 18-H-62 |
Toxin (Protein)
Gene name | tsbT | Uniprot ID | X5E2E6 |
Locus tag | NW959_RS08905 | Protein ID | WP_000031108.1 |
Coordinates | 1862479..1862631 (-) | Length | 51 a.a. |
Antitoxin (Protein)
Gene name | tsbA | Uniprot ID | W8U4V4 |
Locus tag | NW959_RS08910 | Protein ID | WP_001251224.1 |
Coordinates | 1862656..1863255 (-) | Length | 200 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
NW959_RS08890 (NW959_08890) | 1858618..1859439 | + | 822 | WP_258472915.1 | RluA family pseudouridine synthase | - |
NW959_RS08895 (NW959_08895) | 1859902..1861287 | - | 1386 | WP_000116231.1 | class II fumarate hydratase | - |
NW959_RS08900 (NW959_08900) | 1861483..1861878 | - | 396 | WP_000901021.1 | hypothetical protein | - |
NW959_RS08905 (NW959_08905) | 1862479..1862631 | - | 153 | WP_000031108.1 | SAS053 family protein | Toxin |
NW959_RS08910 (NW959_08910) | 1862656..1863255 | - | 600 | WP_001251224.1 | glucosamine-6-phosphate isomerase | Antitoxin |
NW959_RS08915 (NW959_08915) | 1863414..1863884 | - | 471 | WP_000181394.1 | tRNA (uridine(34)/cytosine(34)/5- carboxymethylaminomethyluridine(34)-2'-O)- methyltransferase TrmL | - |
NW959_RS08920 (NW959_08920) | 1863889..1865016 | - | 1128 | WP_258472918.1 | tRNA epoxyqueuosine(34) reductase QueG | - |
NW959_RS08925 (NW959_08925) | 1865167..1865889 | - | 723 | WP_258472919.1 | amino acid ABC transporter ATP-binding protein | - |
NW959_RS08930 (NW959_08930) | 1865882..1867339 | - | 1458 | WP_000649908.1 | ABC transporter permease subunit | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 51 a.a. Molecular weight: 5936.28 Da Isoelectric Point: 3.8962
>T254634 WP_000031108.1 NZ_CP102957:c1862631-1862479 [Staphylococcus aureus]
MSKDKDPKLNYHEEENSMVTDFEDLKELGKEMEQISDQNDQEKNSEEDSQ
MSKDKDPKLNYHEEENSMVTDFEDLKELGKEMEQISDQNDQEKNSEEDSQ
Download Length: 153 bp
Antitoxin
Download Length: 200 a.a. Molecular weight: 22343.47 Da Isoelectric Point: 5.1445
>AT254634 WP_001251224.1 NZ_CP102957:c1863255-1862656 [Staphylococcus aureus]
MAMNFKVFDNSQLVAEYAADIIRKQFNNNPTTIAGFHLDTDQAPVLDELKKNVEKHAVDFSQINILDYDDKKSYFEALGV
PAGQVYPIAYEKDAIELIADKIKTKENKGKLTLQVVSIDEQGKLNVSIRQGLMEAREIFLVVTGANKRDVVEKLYQENGK
TSFEPADLKAHRMVNVILDKEAAAGLPEDVKAYFTSRFA
MAMNFKVFDNSQLVAEYAADIIRKQFNNNPTTIAGFHLDTDQAPVLDELKKNVEKHAVDFSQINILDYDDKKSYFEALGV
PAGQVYPIAYEKDAIELIADKIKTKENKGKLTLQVVSIDEQGKLNVSIRQGLMEAREIFLVVTGANKRDVVEKLYQENGK
TSFEPADLKAHRMVNVILDKEAAAGLPEDVKAYFTSRFA
Download Length: 600 bp
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|