Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) TsaAT/-
Location 817272..817749 Replicon chromosome
Accession NZ_CP102957
Organism Staphylococcus aureus strain 18-H-62

Toxin (Protein)


Gene name TsaT Uniprot ID T1Y7S2
Locus tag NW959_RS03865 Protein ID WP_000052076.1
Coordinates 817272..817460 (-) Length 63 a.a.

Antitoxin (Protein)


Gene name TsaA Uniprot ID T1Y6P8
Locus tag NW959_RS03870 Protein ID WP_001059690.1
Coordinates 817489..817749 (-) Length 87 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
NW959_RS03835 (NW959_03835) 813313..813783 + 471 WP_000824467.1 hypothetical protein -
NW959_RS03840 (NW959_03840) 814124..814810 + 687 WP_072361002.1 thermonuclease family protein -
NW959_RS03845 (NW959_03845) 815167..815367 + 201 WP_001059082.1 cold-shock protein -
NW959_RS03850 (NW959_03850) 815863..816081 - 219 WP_000005886.1 hypothetical protein -
NW959_RS03855 (NW959_03855) 816143..816427 - 285 WP_001004401.1 hypothetical protein -
NW959_RS03860 (NW959_03860) 816515..817084 - 570 WP_001106654.1 lipoprotein N-acylation protein LnsA -
NW959_RS03865 (NW959_03865) 817272..817460 - 189 WP_000052076.1 hypothetical protein Toxin
NW959_RS03870 (NW959_03870) 817489..817749 - 261 WP_001059690.1 hypothetical protein Antitoxin
NW959_RS03875 (NW959_03875) 818089..818292 + 204 WP_000145163.1 sterile alpha motif-like domain-containing protein -
NW959_RS03880 (NW959_03880) 818289..818525 - 237 WP_000368687.1 hypothetical protein -
NW959_RS03885 (NW959_03885) 818750..819331 + 582 WP_001140693.1 histidine phosphatase family protein -
NW959_RS03890 (NW959_03890) 819404..820021 - 618 WP_000255553.1 LysE/ArgO family amino acid transporter -
NW959_RS03895 (NW959_03895) 820177..820671 - 495 WP_000569884.1 GNAT family N-acetyltransferase -
NW959_RS03900 (NW959_03900) 821070..821492 - 423 WP_258414090.1 organic hydroperoxide resistance protein -
NW959_RS03905 (NW959_03905) 821640..822356 + 717 WP_258414091.1 type I 3-dehydroquinate dehydratase -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin


No domain identified.


Antitoxin


No domain identified.



Sequences

Toxin        


Download         Length: 63 a.a.        Molecular weight: 7142.82 Da        Isoelectric Point: 9.9971

>T254632 WP_000052076.1 NZ_CP102957:c817460-817272 [Staphylococcus aureus]
MSLHFAILFWLALIFLVAATFILVLMKKTGKESKKESYLSFTVILYIFGFAILIYTFIFGVL

Download         Length: 189 bp

Antitoxin


Download         Length: 87 a.a.        Molecular weight: 9940.09 Da        Isoelectric Point: 4.0624

>AT254632 WP_001059690.1 NZ_CP102957:c817749-817489 [Staphylococcus aureus]
MNNILLNAINIVITTTFVIFNILITYNKDLDDLCWLLPGIIICGVILIVSFTIAMITKNWLSEILFFINIVLVLYYIYPI
FYSFIG

Download         Length: 261 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A0E0VP18

Antitoxin

Source ID Structure
AlphaFold DB A0A0E0VN56

References