Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | mazEF/MazF(toxin) |
| Location | 2039194..2039723 | Replicon | chromosome |
| Accession | NZ_CP102956 | ||
| Organism | Staphylococcus aureus strain 26-G-G | ||
Toxin (Protein)
| Gene name | mazF | Uniprot ID | - |
| Locus tag | NW981_RS09920 | Protein ID | WP_000621175.1 |
| Coordinates | 2039194..2039556 (-) | Length | 121 a.a. |
Antitoxin (Protein)
| Gene name | mazE | Uniprot ID | T1YCG8 |
| Locus tag | NW981_RS09925 | Protein ID | WP_000948331.1 |
| Coordinates | 2039553..2039723 (-) | Length | 57 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| NW981_RS09900 (NW981_09900) | 2036172..2036942 | - | 771 | WP_001041102.1 | RNA polymerase sigma factor SigB | - |
| NW981_RS09905 (NW981_09905) | 2036917..2037396 | - | 480 | WP_001190829.1 | anti-sigma B factor RsbW | - |
| NW981_RS09910 (NW981_09910) | 2037398..2037724 | - | 327 | WP_001052491.1 | anti-sigma factor antagonist | - |
| NW981_RS09915 (NW981_09915) | 2037843..2038844 | - | 1002 | WP_000390829.1 | PP2C family protein-serine/threonine phosphatase | - |
| NW981_RS09920 (NW981_09920) | 2039194..2039556 | - | 363 | WP_000621175.1 | type II toxin-antitoxin system PemK/MazF family toxin | Toxin |
| NW981_RS09925 (NW981_09925) | 2039553..2039723 | - | 171 | WP_000948331.1 | type II toxin-antitoxin system antitoxin MazE | Antitoxin |
| NW981_RS09930 (NW981_09930) | 2039808..2040956 | - | 1149 | WP_001281154.1 | alanine racemase | - |
| NW981_RS09935 (NW981_09935) | 2041022..2041381 | - | 360 | WP_000581200.1 | holo-ACP synthase | - |
| NW981_RS09940 (NW981_09940) | 2041385..2041876 | - | 492 | WP_001205912.1 | PH domain-containing protein | - |
| NW981_RS09945 (NW981_09945) | 2041863..2043446 | - | 1584 | WP_258410134.1 | PH domain-containing protein | - |
| NW981_RS09950 (NW981_09950) | 2043439..2043918 | - | 480 | WP_216712621.1 | hypothetical protein | - |
| NW981_RS09955 (NW981_09955) | 2044127..2044687 | - | 561 | WP_258410135.1 | K(+)-transporting ATPase subunit C | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 121 a.a. Molecular weight: 13441.69 Da Isoelectric Point: 10.1654
>T254627 WP_000621175.1 NZ_CP102956:c2039556-2039194 [Staphylococcus aureus]
MIRRGDVYLADLSPVQGSEQGGVRPVVIIQNDTGNKYSPTVIVAAITGRINKAKIPTHVEIEKKKYKLDKDSVILLEQIR
TLDKKRLKEKLTYLSDDKMKEVDNALMISLGLNAVAHQKN
MIRRGDVYLADLSPVQGSEQGGVRPVVIIQNDTGNKYSPTVIVAAITGRINKAKIPTHVEIEKKKYKLDKDSVILLEQIR
TLDKKRLKEKLTYLSDDKMKEVDNALMISLGLNAVAHQKN
Download Length: 363 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|