Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | tsbAT/- |
| Location | 1882936..1883712 | Replicon | chromosome |
| Accession | NZ_CP102956 | ||
| Organism | Staphylococcus aureus strain 26-G-G | ||
Toxin (Protein)
| Gene name | tsbT | Uniprot ID | - |
| Locus tag | NW981_RS09025 | Protein ID | WP_258410104.1 |
| Coordinates | 1882936..1883088 (-) | Length | 51 a.a. |
Antitoxin (Protein)
| Gene name | tsbA | Uniprot ID | W8U4V4 |
| Locus tag | NW981_RS09030 | Protein ID | WP_001251224.1 |
| Coordinates | 1883113..1883712 (-) | Length | 200 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| NW981_RS09010 (NW981_09010) | 1878896..1879717 | + | 822 | WP_000669376.1 | RluA family pseudouridine synthase | - |
| NW981_RS09015 (NW981_09015) | 1880178..1881563 | - | 1386 | WP_258410103.1 | class II fumarate hydratase | - |
| NW981_RS09020 (NW981_09020) | 1881759..1882154 | - | 396 | WP_000901023.1 | hypothetical protein | - |
| NW981_RS09025 (NW981_09025) | 1882936..1883088 | - | 153 | WP_258410104.1 | SAS053 family protein | Toxin |
| NW981_RS09030 (NW981_09030) | 1883113..1883712 | - | 600 | WP_001251224.1 | glucosamine-6-phosphate isomerase | Antitoxin |
| NW981_RS09035 (NW981_09035) | 1883871..1884341 | - | 471 | WP_000181394.1 | tRNA (uridine(34)/cytosine(34)/5- carboxymethylaminomethyluridine(34)-2'-O)- methyltransferase TrmL | - |
| NW981_RS09040 (NW981_09040) | 1884346..1885473 | - | 1128 | WP_000379980.1 | tRNA epoxyqueuosine(34) reductase QueG | - |
| NW981_RS09045 (NW981_09045) | 1885624..1886346 | - | 723 | WP_000590809.1 | amino acid ABC transporter ATP-binding protein | - |
| NW981_RS09050 (NW981_09050) | 1886339..1887796 | - | 1458 | WP_000649908.1 | ABC transporter permease subunit | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 51 a.a. Molecular weight: 5918.25 Da Isoelectric Point: 3.8962
>T254626 WP_258410104.1 NZ_CP102956:c1883088-1882936 [Staphylococcus aureus]
MSKDKDPKLNYHEEENSIVTDFEDLKELGKEMEQISDQNDQEKNSEEDSQ
MSKDKDPKLNYHEEENSIVTDFEDLKELGKEMEQISDQNDQEKNSEEDSQ
Download Length: 153 bp
Antitoxin
Download Length: 200 a.a. Molecular weight: 22343.47 Da Isoelectric Point: 5.1445
>AT254626 WP_001251224.1 NZ_CP102956:c1883712-1883113 [Staphylococcus aureus]
MAMNFKVFDNSQLVAEYAADIIRKQFNNNPTTIAGFHLDTDQAPVLDELKKNVEKHAVDFSQINILDYDDKKSYFEALGV
PAGQVYPIAYEKDAIELIADKIKTKENKGKLTLQVVSIDEQGKLNVSIRQGLMEAREIFLVVTGANKRDVVEKLYQENGK
TSFEPADLKAHRMVNVILDKEAAAGLPEDVKAYFTSRFA
MAMNFKVFDNSQLVAEYAADIIRKQFNNNPTTIAGFHLDTDQAPVLDELKKNVEKHAVDFSQINILDYDDKKSYFEALGV
PAGQVYPIAYEKDAIELIADKIKTKENKGKLTLQVVSIDEQGKLNVSIRQGLMEAREIFLVVTGANKRDVVEKLYQENGK
TSFEPADLKAHRMVNVILDKEAAAGLPEDVKAYFTSRFA
Download Length: 600 bp
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|