Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) TsaAT/-
Location 837259..837736 Replicon chromosome
Accession NZ_CP102956
Organism Staphylococcus aureus strain 26-G-G

Toxin (Protein)


Gene name TsaT Uniprot ID T1Y7S2
Locus tag NW981_RS03990 Protein ID WP_000052076.1
Coordinates 837259..837447 (-) Length 63 a.a.

Antitoxin (Protein)


Gene name TsaA Uniprot ID T1Y6P8
Locus tag NW981_RS03995 Protein ID WP_001059690.1
Coordinates 837476..837736 (-) Length 87 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
NW981_RS03960 (NW981_03960) 833249..833770 + 522 WP_000824484.1 hypothetical protein -
NW981_RS03965 (NW981_03965) 834111..834797 + 687 WP_072496504.1 thermonuclease family protein -
NW981_RS03970 (NW981_03970) 835154..835354 + 201 WP_001059082.1 cold-shock protein -
NW981_RS03975 (NW981_03975) 835850..836068 - 219 WP_258410505.1 hypothetical protein -
NW981_RS03980 (NW981_03980) 836130..836414 - 285 WP_001004399.1 hypothetical protein -
NW981_RS03985 (NW981_03985) 836502..837071 - 570 WP_258410506.1 lipoprotein N-acylation protein LnsA -
NW981_RS03990 (NW981_03990) 837259..837447 - 189 WP_000052076.1 hypothetical protein Toxin
NW981_RS03995 (NW981_03995) 837476..837736 - 261 WP_001059690.1 hypothetical protein Antitoxin
NW981_RS04000 (NW981_04000) 838077..838280 + 204 WP_000145163.1 sterile alpha motif-like domain-containing protein -
NW981_RS04005 (NW981_04005) 838277..838513 - 237 WP_000368687.1 hypothetical protein -
NW981_RS04010 (NW981_04010) 838738..839319 + 582 WP_001140697.1 histidine phosphatase family protein -
NW981_RS04015 (NW981_04015) 839392..840009 - 618 WP_258410507.1 LysE/ArgO family amino acid transporter -
NW981_RS04020 (NW981_04020) 840165..840659 - 495 WP_000569884.1 GNAT family N-acetyltransferase -
NW981_RS04025 (NW981_04025) 841058..841480 - 423 WP_000974460.1 organic hydroperoxide resistance protein -
NW981_RS04030 (NW981_04030) 841628..842344 + 717 WP_000150013.1 type I 3-dehydroquinate dehydratase -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin


No domain identified.


Antitoxin


No domain identified.



Sequences

Toxin        


Download         Length: 63 a.a.        Molecular weight: 7142.82 Da        Isoelectric Point: 9.9971

>T254625 WP_000052076.1 NZ_CP102956:c837447-837259 [Staphylococcus aureus]
MSLHFAILFWLALIFLVAATFILVLMKKTGKESKKESYLSFTVILYIFGFAILIYTFIFGVL

Download         Length: 189 bp

Antitoxin


Download         Length: 87 a.a.        Molecular weight: 9940.09 Da        Isoelectric Point: 4.0624

>AT254625 WP_001059690.1 NZ_CP102956:c837736-837476 [Staphylococcus aureus]
MNNILLNAINIVITTTFVIFNILITYNKDLDDLCWLLPGIIICGVILIVSFTIAMITKNWLSEILFFINIVLVLYYIYPI
FYSFIG

Download         Length: 261 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A0E0VP18

Antitoxin

Source ID Structure
AlphaFold DB A0A0E0VN56

References