Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | mazEF/MazF(toxin) |
Location | 2063740..2064269 | Replicon | chromosome |
Accession | NZ_CP102955 | ||
Organism | Staphylococcus aureus strain 28-G-I |
Toxin (Protein)
Gene name | mazF | Uniprot ID | - |
Locus tag | NW961_RS10095 | Protein ID | WP_000621175.1 |
Coordinates | 2063740..2064102 (-) | Length | 121 a.a. |
Antitoxin (Protein)
Gene name | mazE | Uniprot ID | T1YCG8 |
Locus tag | NW961_RS10100 | Protein ID | WP_000948331.1 |
Coordinates | 2064099..2064269 (-) | Length | 57 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
NW961_RS10075 (NW961_10075) | 2060718..2061488 | - | 771 | WP_001041102.1 | RNA polymerase sigma factor SigB | - |
NW961_RS10080 (NW961_10080) | 2061463..2061942 | - | 480 | WP_001190829.1 | anti-sigma B factor RsbW | - |
NW961_RS10085 (NW961_10085) | 2061944..2062270 | - | 327 | WP_001052491.1 | anti-sigma factor antagonist | - |
NW961_RS10090 (NW961_10090) | 2062389..2063390 | - | 1002 | WP_000390829.1 | PP2C family protein-serine/threonine phosphatase | - |
NW961_RS10095 (NW961_10095) | 2063740..2064102 | - | 363 | WP_000621175.1 | type II toxin-antitoxin system PemK/MazF family toxin | Toxin |
NW961_RS10100 (NW961_10100) | 2064099..2064269 | - | 171 | WP_000948331.1 | type II toxin-antitoxin system antitoxin MazE | Antitoxin |
NW961_RS10105 (NW961_10105) | 2064354..2065502 | - | 1149 | WP_258415625.1 | alanine racemase | - |
NW961_RS10110 (NW961_10110) | 2065568..2065927 | - | 360 | WP_061838820.1 | holo-ACP synthase | - |
NW961_RS10115 (NW961_10115) | 2065931..2066422 | - | 492 | WP_072353916.1 | PH domain-containing protein | - |
NW961_RS10120 (NW961_10120) | 2066409..2067992 | - | 1584 | WP_258415626.1 | PH domain-containing protein | - |
NW961_RS10125 (NW961_10125) | 2067985..2068464 | - | 480 | WP_258410777.1 | hypothetical protein | - |
NW961_RS10130 (NW961_10130) | 2068673..2069233 | - | 561 | WP_001092416.1 | K(+)-transporting ATPase subunit C | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 121 a.a. Molecular weight: 13441.69 Da Isoelectric Point: 10.1654
>T254619 WP_000621175.1 NZ_CP102955:c2064102-2063740 [Staphylococcus aureus]
MIRRGDVYLADLSPVQGSEQGGVRPVVIIQNDTGNKYSPTVIVAAITGRINKAKIPTHVEIEKKKYKLDKDSVILLEQIR
TLDKKRLKEKLTYLSDDKMKEVDNALMISLGLNAVAHQKN
MIRRGDVYLADLSPVQGSEQGGVRPVVIIQNDTGNKYSPTVIVAAITGRINKAKIPTHVEIEKKKYKLDKDSVILLEQIR
TLDKKRLKEKLTYLSDDKMKEVDNALMISLGLNAVAHQKN
Download Length: 363 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|