Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) TsaAT/-
Location 839468..839945 Replicon chromosome
Accession NZ_CP102955
Organism Staphylococcus aureus strain 28-G-I

Toxin (Protein)


Gene name TsaT Uniprot ID T1Y7S2
Locus tag NW961_RS03980 Protein ID WP_000052076.1
Coordinates 839468..839656 (-) Length 63 a.a.

Antitoxin (Protein)


Gene name TsaA Uniprot ID -
Locus tag NW961_RS03985 Protein ID WP_258415820.1
Coordinates 839685..839945 (-) Length 87 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
NW961_RS03950 (NW961_03950) 835425..835982 + 558 WP_258412467.1 hypothetical protein -
NW961_RS03955 (NW961_03955) 836323..837009 + 687 WP_258413292.1 thermonuclease family protein -
NW961_RS03960 (NW961_03960) 837366..837566 + 201 WP_001059082.1 cold-shock protein -
NW961_RS03965 (NW961_03965) 838059..838277 - 219 WP_000005886.1 hypothetical protein -
NW961_RS03970 (NW961_03970) 838339..838623 - 285 WP_258415819.1 hypothetical protein -
NW961_RS03975 (NW961_03975) 838711..839280 - 570 WP_001106655.1 lipoprotein N-acylation protein LnsA -
NW961_RS03980 (NW961_03980) 839468..839656 - 189 WP_000052076.1 hypothetical protein Toxin
NW961_RS03985 (NW961_03985) 839685..839945 - 261 WP_258415820.1 hypothetical protein Antitoxin
NW961_RS03990 (NW961_03990) 840286..840489 + 204 WP_000145163.1 sterile alpha motif-like domain-containing protein -
NW961_RS03995 (NW961_03995) 840486..840722 - 237 WP_000368687.1 hypothetical protein -
NW961_RS04000 (NW961_04000) 840947..841528 + 582 WP_001140697.1 histidine phosphatase family protein -
NW961_RS04005 (NW961_04005) 841601..842218 - 618 WP_000255554.1 LysE/ArgO family amino acid transporter -
NW961_RS04010 (NW961_04010) 842373..842867 - 495 WP_000569884.1 GNAT family N-acetyltransferase -
NW961_RS04015 (NW961_04015) 843266..843688 - 423 WP_006189864.1 organic hydroperoxide resistance protein -
NW961_RS04020 (NW961_04020) 843836..844552 + 717 WP_000150019.1 type I 3-dehydroquinate dehydratase -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin


No domain identified.


Antitoxin


No domain identified.



Sequences

Toxin        


Download         Length: 63 a.a.        Molecular weight: 7142.82 Da        Isoelectric Point: 9.9971

>T254616 WP_000052076.1 NZ_CP102955:c839656-839468 [Staphylococcus aureus]
MSLHFAILFWLALIFLVAATFILVLMKKTGKESKKESYLSFTVILYIFGFAILIYTFIFGVL

Download         Length: 189 bp

Antitoxin


Download         Length: 87 a.a.        Molecular weight: 9939.10 Da        Isoelectric Point: 4.3698

>AT254616 WP_258415820.1 NZ_CP102955:c839945-839685 [Staphylococcus aureus]
MNNILLNAINIVITTTFVIFNILITYNKNLDDLCWLLPGIIICGVILIVSFTIAMITKNWLSEILFFINIVLVLYYIYPI
FYSFIG

Download         Length: 261 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A0E0VP18

Antitoxin

Source ID Structure

References