Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | mazEF/MazF(toxin) |
| Location | 2063797..2064326 | Replicon | chromosome |
| Accession | NZ_CP102954 | ||
| Organism | Staphylococcus aureus strain 30-P-10 | ||
Toxin (Protein)
| Gene name | mazF | Uniprot ID | - |
| Locus tag | NW951_RS10030 | Protein ID | WP_000621175.1 |
| Coordinates | 2063797..2064159 (-) | Length | 121 a.a. |
Antitoxin (Protein)
| Gene name | mazE | Uniprot ID | T1YCG8 |
| Locus tag | NW951_RS10035 | Protein ID | WP_000948331.1 |
| Coordinates | 2064156..2064326 (-) | Length | 57 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| NW951_RS10010 (NW951_10010) | 2060775..2061545 | - | 771 | WP_001041107.1 | RNA polymerase sigma factor SigB | - |
| NW951_RS10015 (NW951_10015) | 2061520..2061999 | - | 480 | WP_001190829.1 | anti-sigma B factor RsbW | - |
| NW951_RS10020 (NW951_10020) | 2062001..2062327 | - | 327 | WP_001052491.1 | anti-sigma factor antagonist | - |
| NW951_RS10025 (NW951_10025) | 2062446..2063447 | - | 1002 | WP_000390829.1 | PP2C family protein-serine/threonine phosphatase | - |
| NW951_RS10030 (NW951_10030) | 2063797..2064159 | - | 363 | WP_000621175.1 | type II toxin-antitoxin system PemK/MazF family toxin | Toxin |
| NW951_RS10035 (NW951_10035) | 2064156..2064326 | - | 171 | WP_000948331.1 | type II toxin-antitoxin system antitoxin MazE | Antitoxin |
| NW951_RS10040 (NW951_10040) | 2064411..2065559 | - | 1149 | WP_001281145.1 | alanine racemase | - |
| NW951_RS10045 (NW951_10045) | 2065625..2065984 | - | 360 | WP_000581197.1 | holo-ACP synthase | - |
| NW951_RS10050 (NW951_10050) | 2065988..2066479 | - | 492 | WP_001205912.1 | PH domain-containing protein | - |
| NW951_RS10055 (NW951_10055) | 2066466..2068049 | - | 1584 | WP_001294620.1 | PH domain-containing protein | - |
| NW951_RS10060 (NW951_10060) | 2068042..2068521 | - | 480 | WP_001287079.1 | hypothetical protein | - |
| NW951_RS10065 (NW951_10065) | 2068730..2069290 | - | 561 | WP_001092409.1 | K(+)-transporting ATPase subunit C | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 121 a.a. Molecular weight: 13441.69 Da Isoelectric Point: 10.1654
>T254608 WP_000621175.1 NZ_CP102954:c2064159-2063797 [Staphylococcus aureus]
MIRRGDVYLADLSPVQGSEQGGVRPVVIIQNDTGNKYSPTVIVAAITGRINKAKIPTHVEIEKKKYKLDKDSVILLEQIR
TLDKKRLKEKLTYLSDDKMKEVDNALMISLGLNAVAHQKN
MIRRGDVYLADLSPVQGSEQGGVRPVVIIQNDTGNKYSPTVIVAAITGRINKAKIPTHVEIEKKKYKLDKDSVILLEQIR
TLDKKRLKEKLTYLSDDKMKEVDNALMISLGLNAVAHQKN
Download Length: 363 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|