Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) TsaAT/-
Location 826426..826903 Replicon chromosome
Accession NZ_CP102954
Organism Staphylococcus aureus strain 30-P-10

Toxin (Protein)


Gene name TsaT Uniprot ID T1Y7S2
Locus tag NW951_RS03935 Protein ID WP_000052076.1
Coordinates 826426..826614 (-) Length 63 a.a.

Antitoxin (Protein)


Gene name TsaA Uniprot ID T1Y6P8
Locus tag NW951_RS03940 Protein ID WP_001059690.1
Coordinates 826643..826903 (-) Length 87 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
NW951_RS03905 (NW951_03905) 822380..822937 + 558 WP_258413291.1 hypothetical protein -
NW951_RS03910 (NW951_03910) 823278..823964 + 687 WP_258413292.1 thermonuclease family protein -
NW951_RS03915 (NW951_03915) 824321..824521 + 201 WP_001059082.1 cold-shock protein -
NW951_RS03920 (NW951_03920) 825017..825235 - 219 WP_000005876.1 hypothetical protein -
NW951_RS03925 (NW951_03925) 825297..825581 - 285 WP_001004394.1 hypothetical protein -
NW951_RS03930 (NW951_03930) 825669..826238 - 570 WP_001106652.1 lipoprotein N-acylation protein LnsA -
NW951_RS03935 (NW951_03935) 826426..826614 - 189 WP_000052076.1 hypothetical protein Toxin
NW951_RS03940 (NW951_03940) 826643..826903 - 261 WP_001059690.1 hypothetical protein Antitoxin
NW951_RS03945 (NW951_03945) 827244..827447 + 204 WP_000145163.1 sterile alpha motif-like domain-containing protein -
NW951_RS03950 (NW951_03950) 827444..827680 - 237 WP_000368687.1 hypothetical protein -
NW951_RS03955 (NW951_03955) 827905..828486 + 582 WP_001140697.1 histidine phosphatase family protein -
NW951_RS03960 (NW951_03960) 828559..829176 - 618 WP_086153000.1 LysE/ArgO family amino acid transporter -
NW951_RS03965 (NW951_03965) 829331..829825 - 495 WP_086153001.1 GNAT family N-acetyltransferase -
NW951_RS03970 (NW951_03970) 830223..830645 - 423 WP_000974455.1 organic hydroperoxide resistance protein -
NW951_RS03975 (NW951_03975) 830793..831509 + 717 WP_000150012.1 type I 3-dehydroquinate dehydratase -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin


No domain identified.


Antitoxin


No domain identified.



Sequences

Toxin        


Download         Length: 63 a.a.        Molecular weight: 7142.82 Da        Isoelectric Point: 9.9971

>T254606 WP_000052076.1 NZ_CP102954:c826614-826426 [Staphylococcus aureus]
MSLHFAILFWLALIFLVAATFILVLMKKTGKESKKESYLSFTVILYIFGFAILIYTFIFGVL

Download         Length: 189 bp

Antitoxin


Download         Length: 87 a.a.        Molecular weight: 9940.09 Da        Isoelectric Point: 4.0624

>AT254606 WP_001059690.1 NZ_CP102954:c826903-826643 [Staphylococcus aureus]
MNNILLNAINIVITTTFVIFNILITYNKDLDDLCWLLPGIIICGVILIVSFTIAMITKNWLSEILFFINIVLVLYYIYPI
FYSFIG

Download         Length: 261 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A0E0VP18

Antitoxin

Source ID Structure
AlphaFold DB A0A0E0VN56

References