Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | mazEF/MazF(toxin) |
| Location | 2032776..2033305 | Replicon | chromosome |
| Accession | NZ_CP102953 | ||
| Organism | Staphylococcus aureus strain 32-T-13 | ||
Toxin (Protein)
| Gene name | mazF | Uniprot ID | - |
| Locus tag | NW977_RS09880 | Protein ID | WP_000621175.1 |
| Coordinates | 2032776..2033138 (-) | Length | 121 a.a. |
Antitoxin (Protein)
| Gene name | mazE | Uniprot ID | T1YCG8 |
| Locus tag | NW977_RS09885 | Protein ID | WP_000948331.1 |
| Coordinates | 2033135..2033305 (-) | Length | 57 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| NW977_RS09860 (NW977_09860) | 2029754..2030524 | - | 771 | WP_001041107.1 | RNA polymerase sigma factor SigB | - |
| NW977_RS09865 (NW977_09865) | 2030499..2030978 | - | 480 | WP_001190829.1 | anti-sigma B factor RsbW | - |
| NW977_RS09870 (NW977_09870) | 2030980..2031306 | - | 327 | WP_001052491.1 | anti-sigma factor antagonist | - |
| NW977_RS09875 (NW977_09875) | 2031425..2032426 | - | 1002 | WP_000390829.1 | PP2C family protein-serine/threonine phosphatase | - |
| NW977_RS09880 (NW977_09880) | 2032776..2033138 | - | 363 | WP_000621175.1 | type II toxin-antitoxin system PemK/MazF family toxin | Toxin |
| NW977_RS09885 (NW977_09885) | 2033135..2033305 | - | 171 | WP_000948331.1 | type II toxin-antitoxin system antitoxin MazE | Antitoxin |
| NW977_RS09890 (NW977_09890) | 2033390..2034538 | - | 1149 | WP_072496962.1 | alanine racemase | - |
| NW977_RS09895 (NW977_09895) | 2034604..2034963 | - | 360 | WP_061838820.1 | holo-ACP synthase | - |
| NW977_RS09900 (NW977_09900) | 2034967..2035458 | - | 492 | WP_072496961.1 | PH domain-containing protein | - |
| NW977_RS09905 (NW977_09905) | 2035445..2037028 | - | 1584 | WP_258414916.1 | PH domain-containing protein | - |
| NW977_RS09910 (NW977_09910) | 2037021..2037500 | - | 480 | WP_001287079.1 | hypothetical protein | - |
| NW977_RS09915 (NW977_09915) | 2037709..2038269 | - | 561 | WP_072496959.1 | K(+)-transporting ATPase subunit C | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 121 a.a. Molecular weight: 13441.69 Da Isoelectric Point: 10.1654
>T254598 WP_000621175.1 NZ_CP102953:c2033138-2032776 [Staphylococcus aureus]
MIRRGDVYLADLSPVQGSEQGGVRPVVIIQNDTGNKYSPTVIVAAITGRINKAKIPTHVEIEKKKYKLDKDSVILLEQIR
TLDKKRLKEKLTYLSDDKMKEVDNALMISLGLNAVAHQKN
MIRRGDVYLADLSPVQGSEQGGVRPVVIIQNDTGNKYSPTVIVAAITGRINKAKIPTHVEIEKKKYKLDKDSVILLEQIR
TLDKKRLKEKLTYLSDDKMKEVDNALMISLGLNAVAHQKN
Download Length: 363 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|