Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | mazEF/MazF(toxin) |
| Location | 2038193..2038722 | Replicon | chromosome |
| Accession | NZ_CP102952 | ||
| Organism | Staphylococcus aureus strain 39-B-49 | ||
Toxin (Protein)
| Gene name | mazF | Uniprot ID | - |
| Locus tag | NW967_RS09835 | Protein ID | WP_000621175.1 |
| Coordinates | 2038193..2038555 (-) | Length | 121 a.a. |
Antitoxin (Protein)
| Gene name | mazE | Uniprot ID | T1YCG8 |
| Locus tag | NW967_RS09840 | Protein ID | WP_000948331.1 |
| Coordinates | 2038552..2038722 (-) | Length | 57 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| NW967_RS09815 (NW967_09815) | 2035171..2035941 | - | 771 | WP_001041107.1 | RNA polymerase sigma factor SigB | - |
| NW967_RS09820 (NW967_09820) | 2035916..2036395 | - | 480 | WP_001190829.1 | anti-sigma B factor RsbW | - |
| NW967_RS09825 (NW967_09825) | 2036397..2036723 | - | 327 | WP_001052491.1 | anti-sigma factor antagonist | - |
| NW967_RS09830 (NW967_09830) | 2036842..2037843 | - | 1002 | WP_000390829.1 | PP2C family protein-serine/threonine phosphatase | - |
| NW967_RS09835 (NW967_09835) | 2038193..2038555 | - | 363 | WP_000621175.1 | type II toxin-antitoxin system PemK/MazF family toxin | Toxin |
| NW967_RS09840 (NW967_09840) | 2038552..2038722 | - | 171 | WP_000948331.1 | type II toxin-antitoxin system antitoxin MazE | Antitoxin |
| NW967_RS09845 (NW967_09845) | 2038807..2039955 | - | 1149 | WP_001281145.1 | alanine racemase | - |
| NW967_RS09850 (NW967_09850) | 2040021..2040380 | - | 360 | WP_000581197.1 | holo-ACP synthase | - |
| NW967_RS09855 (NW967_09855) | 2040384..2040875 | - | 492 | WP_072353916.1 | PH domain-containing protein | - |
| NW967_RS09860 (NW967_09860) | 2040862..2042445 | - | 1584 | WP_045173493.1 | PH domain-containing protein | - |
| NW967_RS09865 (NW967_09865) | 2042438..2042917 | - | 480 | WP_001287090.1 | hypothetical protein | - |
| NW967_RS09870 (NW967_09870) | 2043126..2043686 | - | 561 | WP_001092411.1 | K(+)-transporting ATPase subunit C | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 121 a.a. Molecular weight: 13441.69 Da Isoelectric Point: 10.1654
>T254589 WP_000621175.1 NZ_CP102952:c2038555-2038193 [Staphylococcus aureus]
MIRRGDVYLADLSPVQGSEQGGVRPVVIIQNDTGNKYSPTVIVAAITGRINKAKIPTHVEIEKKKYKLDKDSVILLEQIR
TLDKKRLKEKLTYLSDDKMKEVDNALMISLGLNAVAHQKN
MIRRGDVYLADLSPVQGSEQGGVRPVVIIQNDTGNKYSPTVIVAAITGRINKAKIPTHVEIEKKKYKLDKDSVILLEQIR
TLDKKRLKEKLTYLSDDKMKEVDNALMISLGLNAVAHQKN
Download Length: 363 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|