Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | tsbAT/- |
Location | 1881573..1882349 | Replicon | chromosome |
Accession | NZ_CP102952 | ||
Organism | Staphylococcus aureus strain 39-B-49 |
Toxin (Protein)
Gene name | tsbT | Uniprot ID | X5E2E6 |
Locus tag | NW967_RS08935 | Protein ID | WP_000031108.1 |
Coordinates | 1881573..1881725 (-) | Length | 51 a.a. |
Antitoxin (Protein)
Gene name | tsbA | Uniprot ID | - |
Locus tag | NW967_RS08940 | Protein ID | WP_001251230.1 |
Coordinates | 1881750..1882349 (-) | Length | 200 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
NW967_RS08920 (NW967_08920) | 1877367..1878188 | + | 822 | WP_000669376.1 | RluA family pseudouridine synthase | - |
NW967_RS08925 (NW967_08925) | 1878651..1880036 | - | 1386 | WP_000116229.1 | class II fumarate hydratase | - |
NW967_RS08930 (NW967_08930) | 1880232..1880627 | - | 396 | WP_000901023.1 | hypothetical protein | - |
NW967_RS08935 (NW967_08935) | 1881573..1881725 | - | 153 | WP_000031108.1 | SAS053 family protein | Toxin |
NW967_RS08940 (NW967_08940) | 1881750..1882349 | - | 600 | WP_001251230.1 | hypothetical protein | Antitoxin |
NW967_RS08945 (NW967_08945) | 1882508..1882978 | - | 471 | WP_000181394.1 | tRNA (uridine(34)/cytosine(34)/5- carboxymethylaminomethyluridine(34)-2'-O)- methyltransferase TrmL | - |
NW967_RS08950 (NW967_08950) | 1882983..1884110 | - | 1128 | WP_000379988.1 | tRNA epoxyqueuosine(34) reductase QueG | - |
NW967_RS08955 (NW967_08955) | 1884261..1884983 | - | 723 | WP_000590809.1 | amino acid ABC transporter ATP-binding protein | - |
NW967_RS08960 (NW967_08960) | 1884976..1886433 | - | 1458 | WP_000649908.1 | ABC transporter permease subunit | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 51 a.a. Molecular weight: 5936.28 Da Isoelectric Point: 3.8962
>T254588 WP_000031108.1 NZ_CP102952:c1881725-1881573 [Staphylococcus aureus]
MSKDKDPKLNYHEEENSMVTDFEDLKELGKEMEQISDQNDQEKNSEEDSQ
MSKDKDPKLNYHEEENSMVTDFEDLKELGKEMEQISDQNDQEKNSEEDSQ
Download Length: 153 bp
Antitoxin
Download Length: 200 a.a. Molecular weight: 22369.51 Da Isoelectric Point: 4.9728
>AT254588 WP_001251230.1 NZ_CP102952:c1882349-1881750 [Staphylococcus aureus]
MAMNFKVFDNSQLVAEYAADIIRKQFNNNPTTIAGFHLDTDQAPVLDELKKNVEKYAVDFSQINILDYDDKKSYFEALGV
PAGQVYPIAYEKDAIELIADKIKTKENKGKLTLQVVSIDEQGKLNVSIRQGLMEAREIFLVVTGANKRDVVEKLYQENGK
TSFEPADLKAHRMVNVILDKEAAAGLPEDVKAYFTSRFA
MAMNFKVFDNSQLVAEYAADIIRKQFNNNPTTIAGFHLDTDQAPVLDELKKNVEKYAVDFSQINILDYDDKKSYFEALGV
PAGQVYPIAYEKDAIELIADKIKTKENKGKLTLQVVSIDEQGKLNVSIRQGLMEAREIFLVVTGANKRDVVEKLYQENGK
TSFEPADLKAHRMVNVILDKEAAAGLPEDVKAYFTSRFA
Download Length: 600 bp
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|