Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) TsaAT/-
Location 836343..836820 Replicon chromosome
Accession NZ_CP102952
Organism Staphylococcus aureus strain 39-B-49

Toxin (Protein)


Gene name TsaT Uniprot ID T1Y7S2
Locus tag NW967_RS03950 Protein ID WP_000052076.1
Coordinates 836343..836531 (-) Length 63 a.a.

Antitoxin (Protein)


Gene name TsaA Uniprot ID T1Y6P8
Locus tag NW967_RS03955 Protein ID WP_001059690.1
Coordinates 836560..836820 (-) Length 87 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
NW967_RS03920 (NW967_03920) 832372..832854 + 483 WP_258411588.1 hypothetical protein -
NW967_RS03925 (NW967_03925) 833195..833881 + 687 WP_001806958.1 thermonuclease family protein -
NW967_RS03930 (NW967_03930) 834238..834438 + 201 WP_001059082.1 cold-shock protein -
NW967_RS03935 (NW967_03935) 834934..835152 - 219 WP_006189856.1 hypothetical protein -
NW967_RS03940 (NW967_03940) 835214..835498 - 285 WP_001004401.1 hypothetical protein -
NW967_RS03945 (NW967_03945) 835586..836155 - 570 WP_001106654.1 lipoprotein N-acylation protein LnsA -
NW967_RS03950 (NW967_03950) 836343..836531 - 189 WP_000052076.1 hypothetical protein Toxin
NW967_RS03955 (NW967_03955) 836560..836820 - 261 WP_001059690.1 hypothetical protein Antitoxin
NW967_RS03960 (NW967_03960) 837161..837364 + 204 WP_258411589.1 sterile alpha motif-like domain-containing protein -
NW967_RS03965 (NW967_03965) 837361..837597 - 237 WP_000368687.1 hypothetical protein -
NW967_RS03970 (NW967_03970) 837822..838403 + 582 WP_216712319.1 histidine phosphatase family protein -
NW967_RS03975 (NW967_03975) 838476..839093 - 618 WP_258411590.1 LysE/ArgO family amino acid transporter -
NW967_RS03980 (NW967_03980) 839248..839742 - 495 WP_000569884.1 GNAT family N-acetyltransferase -
NW967_RS03985 (NW967_03985) 840141..840563 - 423 WP_000974460.1 organic hydroperoxide resistance protein -
NW967_RS03990 (NW967_03990) 840711..841427 + 717 WP_258411591.1 type I 3-dehydroquinate dehydratase -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin


No domain identified.


Antitoxin


No domain identified.



Sequences

Toxin        


Download         Length: 63 a.a.        Molecular weight: 7142.82 Da        Isoelectric Point: 9.9971

>T254586 WP_000052076.1 NZ_CP102952:c836531-836343 [Staphylococcus aureus]
MSLHFAILFWLALIFLVAATFILVLMKKTGKESKKESYLSFTVILYIFGFAILIYTFIFGVL

Download         Length: 189 bp

Antitoxin


Download         Length: 87 a.a.        Molecular weight: 9940.09 Da        Isoelectric Point: 4.0624

>AT254586 WP_001059690.1 NZ_CP102952:c836820-836560 [Staphylococcus aureus]
MNNILLNAINIVITTTFVIFNILITYNKDLDDLCWLLPGIIICGVILIVSFTIAMITKNWLSEILFFINIVLVLYYIYPI
FYSFIG

Download         Length: 261 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A0E0VP18

Antitoxin

Source ID Structure
AlphaFold DB A0A0E0VN56

References