Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | vapBC/VapC-VagC |
Location | 640263..640909 | Replicon | chromosome |
Accession | NZ_CP102951 | ||
Organism | Pseudomonas sp. LS1212 |
Toxin (Protein)
Gene name | vapC | Uniprot ID | - |
Locus tag | NVV94_RS02890 | Protein ID | WP_258445757.1 |
Coordinates | 640493..640909 (+) | Length | 139 a.a. |
Antitoxin (Protein)
Gene name | vapB | Uniprot ID | - |
Locus tag | NVV94_RS02885 | Protein ID | WP_258445756.1 |
Coordinates | 640263..640493 (+) | Length | 77 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
NVV94_RS02865 (NVV94_02865) | 635470..636006 | + | 537 | WP_258445752.1 | NUDIX hydrolase | - |
NVV94_RS02870 (NVV94_02870) | 636191..636562 | + | 372 | WP_258445753.1 | translation initiation factor Sui1 | - |
NVV94_RS02875 (NVV94_02875) | 636761..638674 | + | 1914 | WP_258445754.1 | arginine decarboxylase | - |
NVV94_RS02880 (NVV94_02880) | 638815..640164 | - | 1350 | WP_258445755.1 | MATE family efflux transporter | - |
NVV94_RS02885 (NVV94_02885) | 640263..640493 | + | 231 | WP_258445756.1 | antitoxin | Antitoxin |
NVV94_RS02890 (NVV94_02890) | 640493..640909 | + | 417 | WP_258445757.1 | tRNA(fMet)-specific endonuclease VapC | Toxin |
NVV94_RS02895 (NVV94_02895) | 640997..645907 | + | 4911 | WP_258445758.1 | alpha-2-macroglobulin | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 139 a.a. Molecular weight: 15219.57 Da Isoelectric Point: 7.3831
>T254581 WP_258445757.1 NZ_CP102951:640493-640909 [Pseudomonas sp. LS1212]
MLKYMLDTNICIFTLKNKPQEVREAFTRHHGQLCISTVTLMELIYGAEKSAAPEKNLAVIEGFAARLEVLSYDNQAAAHS
GQLRAELAKSGKPIGPYDQMIAGHARSLGLILVTNNLGEFERVKGLRLEDWVNAHAIG
MLKYMLDTNICIFTLKNKPQEVREAFTRHHGQLCISTVTLMELIYGAEKSAAPEKNLAVIEGFAARLEVLSYDNQAAAHS
GQLRAELAKSGKPIGPYDQMIAGHARSLGLILVTNNLGEFERVKGLRLEDWVNAHAIG
Download Length: 417 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|
Antitoxin
Source | ID | Structure |
---|