Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | mazEF/PemK-MazE |
| Location | 1171342..1171868 | Replicon | chromosome |
| Accession | NZ_CP102950 | ||
| Organism | Arthrobacter sp. CJ23 | ||
Toxin (Protein)
| Gene name | mazF | Uniprot ID | - |
| Locus tag | NVV90_RS05255 | Protein ID | WP_258440139.1 |
| Coordinates | 1171542..1171868 (+) | Length | 109 a.a. |
Antitoxin (Protein)
| Gene name | mazE | Uniprot ID | - |
| Locus tag | NVV90_RS05250 | Protein ID | WP_258440138.1 |
| Coordinates | 1171342..1171545 (+) | Length | 68 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| NVV90_RS05220 (NVV90_05220) | 1166471..1167700 | - | 1230 | WP_258440132.1 | NAD(P)/FAD-dependent oxidoreductase | - |
| NVV90_RS05225 (NVV90_05225) | 1167742..1168104 | - | 363 | WP_258440133.1 | VOC family protein | - |
| NVV90_RS05230 (NVV90_05230) | 1168169..1168633 | + | 465 | WP_258440134.1 | MarR family transcriptional regulator | - |
| NVV90_RS05235 (NVV90_05235) | 1168673..1169767 | - | 1095 | WP_258440135.1 | thioredoxin domain-containing protein | - |
| NVV90_RS05240 (NVV90_05240) | 1170116..1170412 | + | 297 | WP_258440136.1 | hypothetical protein | - |
| NVV90_RS05245 (NVV90_05245) | 1170454..1171227 | - | 774 | WP_258440137.1 | alpha/beta hydrolase | - |
| NVV90_RS05250 (NVV90_05250) | 1171342..1171545 | + | 204 | WP_258440138.1 | antitoxin MazE family protein | Antitoxin |
| NVV90_RS05255 (NVV90_05255) | 1171542..1171868 | + | 327 | WP_258440139.1 | type II toxin-antitoxin system PemK/MazF family toxin | Toxin |
| NVV90_RS05260 (NVV90_05260) | 1171836..1172369 | - | 534 | WP_258440140.1 | DUF2220 domain-containing protein | - |
| NVV90_RS05265 (NVV90_05265) | 1172326..1172964 | - | 639 | WP_258440141.1 | DUF3322 domain-containing protein | - |
| NVV90_RS05270 (NVV90_05270) | 1172957..1176379 | - | 3423 | WP_258440142.1 | ATP-binding protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Genomic island | - | - | 1130437..1172964 | 42527 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 109 a.a. Molecular weight: 11866.79 Da Isoelectric Point: 8.7087
>T254579 WP_258440139.1 NZ_CP102950:1171542-1171868 [Arthrobacter sp. CJ23]
VNRGELWTVSGGTYAQKPRPALIIQDDLFEASESVTLLPLTSHLTDAPLLRLTVDPGQLTGLERVSQIMIDKLTTVRRVN
LGQRIGRIDSKTMVAVEQSLIVFLGLGR
VNRGELWTVSGGTYAQKPRPALIIQDDLFEASESVTLLPLTSHLTDAPLLRLTVDPGQLTGLERVSQIMIDKLTTVRRVN
LGQRIGRIDSKTMVAVEQSLIVFLGLGR
Download Length: 327 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|
Antitoxin
| Source | ID | Structure |
|---|