254578

Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) phd-doc/Doc-Phd
Location 71814..72415 Replicon plasmid unnamed2
Accession NZ_CP102949
Organism Escherichia coli strain SCAID WND1-2022 (119)

Toxin (Protein)


Gene name doc Uniprot ID V0AJ64
Locus tag NW339_RS25605 Protein ID WP_001216034.1
Coordinates 71814..72194 (-) Length 127 a.a.

Antitoxin (Protein)


Gene name phd Uniprot ID U9YQH9
Locus tag NW339_RS25610 Protein ID WP_001190712.1
Coordinates 72194..72415 (-) Length 74 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
NW339_RS25580 (NW339_25580) 67254..68738 - 1485 WP_000124150.1 terminase -
NW339_RS25585 (NW339_25585) 68738..69931 - 1194 WP_160188011.1 terminase -
NW339_RS25590 (NW339_25590) 70018..70470 - 453 WP_001312282.1 late promoter-activating protein (Gp10) -
NW339_RS25595 (NW339_25595) 70559..71602 - 1044 WP_258390152.1 DUF968 domain-containing protein -
NW339_RS25600 (NW339_25600) 71630..71809 - 180 WP_000113019.1 hypothetical protein -
NW339_RS25605 (NW339_25605) 71814..72194 - 381 WP_001216034.1 type II toxin-antitoxin system death-on-curing family toxin Toxin
NW339_RS25610 (NW339_25610) 72194..72415 - 222 WP_001190712.1 type II toxin-antitoxin system Phd/YefM family antitoxin Antitoxin
NW339_RS25615 (NW339_25615) 72488..72877 - 390 WP_000506726.1 S24 family peptidase -
NW339_RS25620 (NW339_25620) 73001..73252 - 252 WP_001283837.1 DNA polymerase III subunit theta -
NW339_RS25625 (NW339_25625) 73285..73635 + 351 WP_000551789.1 hypothetical protein -
NW339_RS25630 (NW339_25630) 73620..73904 - 285 WP_001142394.1 hypothetical protein -
NW339_RS25635 (NW339_25635) 73888..74970 - 1083 WP_258390153.1 hypothetical protein -
NW339_RS25640 (NW339_25640) 74967..75176 - 210 WP_129547433.1 hypothetical protein -
NW339_RS25645 (NW339_25645) 75178..75573 - 396 WP_258390154.1 hypothetical protein -
NW339_RS25650 (NW339_25650) 75575..75934 - 360 WP_088251332.1 hypothetical protein -
NW339_RS25655 (NW339_25655) 75931..76107 - 177 WP_000753058.1 hypothetical protein -
NW339_RS25660 (NW339_25660) 76100..76282 - 183 WP_001224665.1 hypothetical protein -
NW339_RS25665 (NW339_25665) 76411..76722 - 312 WP_001002676.1 hypothetical protein -
NW339_RS25670 (NW339_25670) 76715..76969 - 255 WP_258390155.1 hypothetical protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Non-Mobilizable plasmid - - 1..99647 99647


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Death on curing protein

(2-123)

Antitoxin

Type II toxin-antitoxin system, antitoxin Phd/YefM

(1-51)


Sequences

Toxin        


Download         Length: 127 a.a.        Molecular weight: 13615.32 Da        Isoelectric Point: 5.1514

>T254578 WP_001216034.1 NZ_CP102949:c72194-71814 [Escherichia coli]
MRHISPEELIALHDANINRYGGLPGMSDPGRAEAIIGRVQARVAYEEITDLFEVSATYLVATARGHIFNDANKRTALNSA
LLFLRRNGVQVFDSPELADLTVGAATGEISVSSVADTLRRLYGSAE

Download         Length: 381 bp

Antitoxin


Download         Length: 74 a.a.        Molecular weight: 8133.10 Da        Isoelectric Point: 4.7708

>AT254578 WP_001190712.1 NZ_CP102949:c72415-72194 [Escherichia coli]
MQSINFRTARGNLSEVLNNVEAGEEVEITRRGREPAVIVSKATFEAYKKAALDAEFASLFDTLDSTNKELVNR

Download         Length: 222 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB V0AJ64

Antitoxin

Source ID Structure
AlphaFold DB A0A829CJB6

References