Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | ccdAB/CcdA(antitoxin) |
Location | 90317..90842 | Replicon | plasmid unnamed1 |
Accession | NZ_CP102948 | ||
Organism | Escherichia coli strain SCAID WND1-2022 (119) |
Toxin (Protein)
Gene name | ccdB | Uniprot ID | V0SSI5 |
Locus tag | NW339_RS25170 | Protein ID | WP_001159868.1 |
Coordinates | 90537..90842 (+) | Length | 102 a.a. |
Antitoxin (Protein)
Gene name | ccdA | Uniprot ID | S1PPD8 |
Locus tag | NW339_RS25165 | Protein ID | WP_000813634.1 |
Coordinates | 90317..90535 (+) | Length | 73 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
NW339_RS25145 (85536) | 85536..86792 | + | 1257 | Protein_105 | type I restriction-modification system subunit M | - |
NW339_RS25150 (86844) | 86844..87541 | + | 698 | WP_223216377.1 | IS1-like element IS1A family transposase | - |
NW339_RS25155 (87678) | 87678..88571 | - | 894 | WP_001553853.1 | S-4TM family putative pore-forming effector | - |
NW339_RS25160 (88614) | 88614..89609 | - | 996 | WP_000246636.1 | hypothetical protein | - |
NW339_RS25165 (90317) | 90317..90535 | + | 219 | WP_000813634.1 | type II toxin-antitoxin system antitoxin CcdA | Antitoxin |
NW339_RS25170 (90537) | 90537..90842 | + | 306 | WP_001159868.1 | type II toxin-antitoxin system toxin CcdB | Toxin |
NW339_RS25175 (90843) | 90843..91649 | + | 807 | WP_000016982.1 | site-specific integrase | - |
NW339_RS25180 (92423) | 92423..93178 | + | 756 | WP_000852146.1 | replication initiation protein RepE | - |
NW339_RS25185 (93766) | 93766..94932 | + | 1167 | WP_000772446.1 | plasmid-partitioning protein SopA | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Non-Mobilizable plasmid | blaCTX-M-27 | senB | 1..105437 | 105437 | |
- | inside | IScluster/Tn | - | - | 78846..87541 | 8695 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 102 a.a. Molecular weight: 11706.51 Da Isoelectric Point: 6.4674
>T254577 WP_001159868.1 NZ_CP102948:90537-90842 [Escherichia coli]
MQFKVYTYKRESRYRLFVDVQSDIIDTPGRRMVIPLASARLLSDKVSRELYPVVHIGDESWRMMTTDMASVPVSVIGEEV
ADLSHRENDIKNAINLMFWGI
MQFKVYTYKRESRYRLFVDVQSDIIDTPGRRMVIPLASARLLSDKVSRELYPVVHIGDESWRMMTTDMASVPVSVIGEEV
ADLSHRENDIKNAINLMFWGI
Download Length: 306 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|